KEGG   Enterococcus faecalis D32: EFD32_0051Help
Entry
EFD32_0051        CDS       T02172                                 

Definition
4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
efd  Enterococcus faecalis D32
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:efd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EFD32_0051
Enzymes [BR:efd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     EFD32_0051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
58349..59200
Genome map
AA seq 283 aa AA seqDB search
MEIIERAPAKINLGLDVLHKRVDGYHEVESIFASVDLADHLTFENLEEDIIRIETDSSFL
PVDRRNHVYQAVDLLKRTYNIHKGIKIYIEKRIPVAAGLAGGSSDCAAALRGLNKLWNLG
LTMDELCEIGSQIGMDVPYCLRGGTAFANGRGEKIETLPTMPQCWIVLVKPRISVSTSTV
FNDLAVDELHHPDIAGLRIAIENGDYTGMTQTVGNALESVTIARHPIVQQIKDRMLKYGA
DAALMSGSGPTVFALCEKKTRAQRIYNGLKGFCEEVYLVRTLK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggaaataatcgaacgagctcctgcgaaaattaatcttgggttagatgttctgcataaa
cgtgtggatggctatcatgaagttgaatctatttttgcaagtgtagatttagccgatcat
ttaacttttgaaaatctagaagaagacatcattcgtattgaaacggacagctctttttta
cccgtggatcgacggaatcatgtctatcaagcagttgacttattaaagcgtacctataat
attcataaaggaattaaaatatatattgaaaaacgtatccccgtggcagctggtttagca
ggggggagcagtgactgtgccgcagcattacgaggcttgaacaaactgtggaatctgggg
ttgacgatggacgaactctgtgaaattggcagccaaattggtatggatgttccttattgt
ttaaggggcggaacagcctttgcaaacggacgtggggagaaaattgaaacattaccgacc
atgcctcaatgttggattgtgttagttaaaccaagaattagtgtatctactagtaccgtt
tttaatgatttagcggtagatgaattgcaccatccagatattgctggactaagaatagcc
atcgaaaatggtgattatactgggatgacccagacggtcggcaatgcgttggaaagtgtc
acgattgccagacatccgatcgtgcaacaaatcaaggatcgcatgctgaagtacggcgct
gatgcagcgttgatgagcggtagtggaccgacagtctttgctttatgtgaaaagaaaaca
cgagcacaacggatttataatggacttaaaggcttttgtgaagaagtttatttggttcgg
acattgaaataa

DBGET integrated database retrieval system