KEGG   Enterococcus faecalis D32: EFD32_0051Help
Entry
EFD32_0051        CDS       T02172                                 

Definition
4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
efd  Enterococcus faecalis D32
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:efd00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
58349..59200
Genome map
AA seq 283 aa AA seqDB search
MEIIERAPAKINLGLDVLHKRVDGYHEVESIFASVDLADHLTFENLEEDIIRIETDSSFL
PVDRRNHVYQAVDLLKRTYNIHKGIKIYIEKRIPVAAGLAGGSSDCAAALRGLNKLWNLG
LTMDELCEIGSQIGMDVPYCLRGGTAFANGRGEKIETLPTMPQCWIVLVKPRISVSTSTV
FNDLAVDELHHPDIAGLRIAIENGDYTGMTQTVGNALESVTIARHPIVQQIKDRMLKYGA
DAALMSGSGPTVFALCEKKTRAQRIYNGLKGFCEEVYLVRTLK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggaaataatcgaacgagctcctgcgaaaattaatcttgggttagatgttctgcataaa
cgtgtggatggctatcatgaagttgaatctatttttgcaagtgtagatttagccgatcat
ttaacttttgaaaatctagaagaagacatcattcgtattgaaacggacagctctttttta
cccgtggatcgacggaatcatgtctatcaagcagttgacttattaaagcgtacctataat
attcataaaggaattaaaatatatattgaaaaacgtatccccgtggcagctggtttagca
ggggggagcagtgactgtgccgcagcattacgaggcttgaacaaactgtggaatctgggg
ttgacgatggacgaactctgtgaaattggcagccaaattggtatggatgttccttattgt
ttaaggggcggaacagcctttgcaaacggacgtggggagaaaattgaaacattaccgacc
atgcctcaatgttggattgtgttagttaaaccaagaattagtgtatctactagtaccgtt
tttaatgatttagcggtagatgaattgcaccatccagatattgctggactaagaatagcc
atcgaaaatggtgattatactgggatgacccagacggtcggcaatgcgttggaaagtgtc
acgattgccagacatccgatcgtgcaacaaatcaaggatcgcatgctgaagtacggcgct
gatgcagcgttgatgagcggtagtggaccgacagtctttgctttatgtgaaaagaaaaca
cgagcacaacggatttataatggacttaaaggcttttgtgaagaagtttatttggttcgg
acattgaaataa

DBGET integrated database retrieval system