KEGG   Enterococcus faecalis D32: EFD32_0064Help
Entry
EFD32_0064        CDS       T02172                                 

Definition
holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
efd  Enterococcus faecalis D32
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:efd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EFD32_0064
Enzymes [BR:efd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EFD32_0064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
74742..75356
Genome map
AA seq 204 aa AA seqDB search
MYEYIIGKVTFVSPYYIVVETNGIGYQISVDNPYRYSGKMDTDIKLYLHQVVREDAQLLF
GFGSLEEKQLFLKLISVSGIGPKSGLAIMASVADHGGLINAIEGEDVTYLTKFPGVGKKT
AQQMILDLKGKLGELESSEAAVAAMTATEVVTTSNQALAEALEALSALGYSDREIKRITK
QLEALGETTTDVYLSNALKFMMKR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaatatattattggaaaagtaacgtttgttagcccatactatattgtcgttgaa
acaaatggcattggctatcagatttcagtcgataacccgtatcgctattcaggaaaaatg
gatacggacattaaactatatcttcaccaagtcgtgcgggaagatgcacaacttttattt
ggttttggcagtttagaagaaaaacaattgttcttaaaattaatcagtgtctctggaatt
ggccctaaaagtgggttagctatcatggcttctgtggctgatcatggtggtttaatcaat
gcaattgaaggggaagacgttacatatttaacgaagttcccaggtgttggcaagaaaaca
gcccaacaaatgattttagatttaaaaggaaaactaggcgaattagagtcttccgaagca
gcggttgcggccatgaccgcaaccgaagtggtgacaacaagcaatcaagcattggcagaa
gcgttagaagcattaagtgccctaggctacagtgaccgagagattaagcgtatcactaag
caattggaagcgttaggtgagacaacgacagatgtttatttaagcaatgcgttaaaattc
atgatgaaacgctaa

DBGET integrated database retrieval system