KEGG   Enterococcus faecalis D32: EFD32_0064Help
Entry
EFD32_0064        CDS       T02172                                 

Definition
holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
efd  Enterococcus faecalis D32
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:efd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
74742..75356
Genome map
AA seq 204 aa AA seqDB search
MYEYIIGKVTFVSPYYIVVETNGIGYQISVDNPYRYSGKMDTDIKLYLHQVVREDAQLLF
GFGSLEEKQLFLKLISVSGIGPKSGLAIMASVADHGGLINAIEGEDVTYLTKFPGVGKKT
AQQMILDLKGKLGELESSEAAVAAMTATEVVTTSNQALAEALEALSALGYSDREIKRITK
QLEALGETTTDVYLSNALKFMMKR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaatatattattggaaaagtaacgtttgttagcccatactatattgtcgttgaa
acaaatggcattggctatcagatttcagtcgataacccgtatcgctattcaggaaaaatg
gatacggacattaaactatatcttcaccaagtcgtgcgggaagatgcacaacttttattt
ggttttggcagtttagaagaaaaacaattgttcttaaaattaatcagtgtctctggaatt
ggccctaaaagtgggttagctatcatggcttctgtggctgatcatggtggtttaatcaat
gcaattgaaggggaagacgttacatatttaacgaagttcccaggtgttggcaagaaaaca
gcccaacaaatgattttagatttaaaaggaaaactaggcgaattagagtcttccgaagca
gcggttgcggccatgaccgcaaccgaagtggtgacaacaagcaatcaagcattggcagaa
gcgttagaagcattaagtgccctaggctacagtgaccgagagattaagcgtatcactaag
caattggaagcgttaggtgagacaacgacagatgtttatttaagcaatgcgttaaaattc
atgatgaaacgctaa

DBGET integrated database retrieval system