KEGG   Enterococcus faecalis D32: EFD32_0858Help
Entry
EFD32_0858        CDS       T02172                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
efd  Enterococcus faecalis D32
Pathway
efd00010  Glycolysis / Gluconeogenesis
efd00030  Pentose phosphate pathway
efd00051  Fructose and mannose metabolism
efd00052  Galactose metabolism
efd00680  Methane metabolism
efd01100  Metabolic pathways
efd01110  Biosynthesis of secondary metabolites
efd01120  Microbial metabolism in diverse environments
efd01130  Biosynthesis of antibiotics
efd01200  Carbon metabolism
efd01230  Biosynthesis of amino acids
efd03018  RNA degradation
Module
efd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:efd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFD32_0858
   00030 Pentose phosphate pathway
    EFD32_0858
   00051 Fructose and mannose metabolism
    EFD32_0858
   00052 Galactose metabolism
    EFD32_0858
  Energy metabolism
   00680 Methane metabolism
    EFD32_0858
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    EFD32_0858
Enzymes [BR:efd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EFD32_0858
Protein phosphatases and associated proteins [BR:efd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EFD32_0858
Messenger RNA biogenesis [BR:efd03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     EFD32_0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AFO43748
Position
889209..890171
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDAPGMNAAIRAVVRKSIFDGIEVYGINYGFAGLVAGDIRRLDVADVGDK
IQRGGTFLYSARYPEFATEEGQLKGIEQLKKFGIEGLVVIGGDGSYHGAMALTKRGFPAV
GIPGTIDNDIPGTDFTIGFDTAINTVLESIDRIRDTATSHVRTFVIEVMGRNAGDIALWS
GVAGGADEIIIPEHDFDMKNVAKRIQEGRDRGKKHCLIILAEGVMGGNEFADKLSEYGDF
HTRVSILGHVVRGGSPSARDRVLASKFGSYAVELLKEGKGGLCIGMLDNQVVAADIIDTL
ENNKHKPDLSLYELNHEISF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattggtattttaaccagcgggggagatgcccctggaatgaacgctgcaatt
cgtgcagtcgtacgcaaaagtatttttgatggaatcgaagtttacggtattaactatgga
tttgccggtttagtcgcaggcgacatccgtcgtttagatgttgctgacgttggcgataag
attcaacgtggtggaacattcttgtactctgctcgttatcctgaatttgctactgaagaa
gggcaattaaaaggaatcgaacaattgaaaaaattcggtattgaaggcttagttgttatt
ggtggagacggttcttatcatggcgcaatggctttgacaaaacgtggtttccccgctgtt
ggaattcctggaacaattgataatgatattcctggaacagatttcacaatcggttttgat
acagcgattaacactgttttggaatcaattgaccgaattcgtgatacagcaacttctcat
gttcgtacattcgttatcgaagtaatgggacgtaacgctggtgatatcgcattgtggtca
ggcgtggcaggcggagcagatgaaatcattattcctgaacatgattttgatatgaaaaac
gttgccaaacgtattcaagaaggccgcgaccgcgggaaaaaacattgcttaatcatttta
gcagaaggcgtaatgggtggaaatgaatttgctgataaactttctgaatacggtgatttc
catacgcgtgtatcaattttaggacacgtggttcgtgggggctcgccaagtgctcgtgac
cgtgtattagcaagtaaatttgggtcatatgctgttgaacttctaaaagaaggcaaaggc
ggtttatgtatcggtatgttagataaccaagtagttgcagctgatattattgatacgtta
gaaaacaataaacacaaaccagatttatctctttatgagttaaatcatgaaatttctttt
taa

DBGET integrated database retrieval system