KEGG   Enterococcus faecalis D32: EFD32_0858Help
Entry
EFD32_0858        CDS       T02172                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
efd  Enterococcus faecalis D32
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:efd01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:efd01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:efd00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:efd00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:efd00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:efd00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:efd00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
889209..890171
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDAPGMNAAIRAVVRKSIFDGIEVYGINYGFAGLVAGDIRRLDVADVGDK
IQRGGTFLYSARYPEFATEEGQLKGIEQLKKFGIEGLVVIGGDGSYHGAMALTKRGFPAV
GIPGTIDNDIPGTDFTIGFDTAINTVLESIDRIRDTATSHVRTFVIEVMGRNAGDIALWS
GVAGGADEIIIPEHDFDMKNVAKRIQEGRDRGKKHCLIILAEGVMGGNEFADKLSEYGDF
HTRVSILGHVVRGGSPSARDRVLASKFGSYAVELLKEGKGGLCIGMLDNQVVAADIIDTL
ENNKHKPDLSLYELNHEISF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattggtattttaaccagcgggggagatgcccctggaatgaacgctgcaatt
cgtgcagtcgtacgcaaaagtatttttgatggaatcgaagtttacggtattaactatgga
tttgccggtttagtcgcaggcgacatccgtcgtttagatgttgctgacgttggcgataag
attcaacgtggtggaacattcttgtactctgctcgttatcctgaatttgctactgaagaa
gggcaattaaaaggaatcgaacaattgaaaaaattcggtattgaaggcttagttgttatt
ggtggagacggttcttatcatggcgcaatggctttgacaaaacgtggtttccccgctgtt
ggaattcctggaacaattgataatgatattcctggaacagatttcacaatcggttttgat
acagcgattaacactgttttggaatcaattgaccgaattcgtgatacagcaacttctcat
gttcgtacattcgttatcgaagtaatgggacgtaacgctggtgatatcgcattgtggtca
ggcgtggcaggcggagcagatgaaatcattattcctgaacatgattttgatatgaaaaac
gttgccaaacgtattcaagaaggccgcgaccgcgggaaaaaacattgcttaatcatttta
gcagaaggcgtaatgggtggaaatgaatttgctgataaactttctgaatacggtgatttc
catacgcgtgtatcaattttaggacacgtggttcgtgggggctcgccaagtgctcgtgac
cgtgtattagcaagtaaatttgggtcatatgctgttgaacttctaaaagaaggcaaaggc
ggtttatgtatcggtatgttagataaccaagtagttgcagctgatattattgatacgtta
gaaaacaataaacacaaaccagatttatctctttatgagttaaatcatgaaatttctttt
taa

DBGET integrated database retrieval system