KEGG   Enterococcus faecalis D32: EFD32_0879Help
Entry
EFD32_0879        CDS       T02172                                 

Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
efd  Enterococcus faecalis D32
Pathway
efd00010  Glycolysis / Gluconeogenesis
efd00052  Galactose metabolism
efd01100  Metabolic pathways
efd01110  Biosynthesis of secondary metabolites
efd01120  Microbial metabolism in diverse environments
efd01130  Biosynthesis of antibiotics
Module
efd_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:efd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFD32_0879
   00052 Galactose metabolism
    EFD32_0879
Enzymes [BR:efd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     EFD32_0879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AFO43769
Position
complement(919493..920539)
Genome map
AA seq 348 aa AA seqDB search
MIILTISTESFGQGMLLYTLTNKNGVTLKATDFGARIVALDVPLTKNESRSLVLGFPSAD
EYLSKDLYFGATIGRTAGRIADGSFELAGKKYQTMINTPTQTTLHGGTPGFESKKWHSEI
QEAQANPSVKFWLESPAGENGFPGNLTVSVTYTLTEENEWQIEYQATTDEQTLFNPTNHV
YFNLTGNPTIPIDAHELQINAQKFVPLDERVLPLGELASVDQTAFDLQKPKKLAEVFSST
DEQIQKMNGFDHPFILTNHDLINPDVILKSPTKDITLEMFTDQPSVVIFSANFADNGPDI
QGQKLVNHGALTFETQVCPGAERFPLFGSITLSPEQEFHSTTRFKLIY
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
ttgattattttgactatttcaactgaatcatttggacaaggaatgcttctttacacactg
acgaataaaaatggtgtgactttaaaagcaacagattttggtgcgcgaattgttgcgctc
gacgttcctcttacaaaaaatgaatcccgatcactcgtgctaggctttccctcagcagat
gaatatttgtctaaagacttatattttggtgcaacaattggtcgaacagctggccgaatt
gccgatggctcctttgaactagcgggtaaaaagtatcaaacgatgattaatactcctact
caaacaacacttcacggtggcacacctgggtttgaaagtaaaaaatggcacagcgaaatc
caagaggcacaagcgaatccttctgtgaaattttggctagagagtcctgctggtgaaaat
ggttttcctggaaatctcactgtttcagtcacgtatacattgactgaagaaaatgaatgg
caaattgagtatcaggcaactacagatgaacaaacacttttcaatccaaccaatcatgtc
tactttaatttaactggaaatcctacaatccccattgatgcgcatgagttacaaataaat
gcccaaaagtttgtcccgcttgatgaaagagttttaccgcttggagaattagcttccgtc
gaccagacagcttttgatttacaaaaacctaaaaaattagctgaggttttttcaagtacc
gatgaacaaattcaaaagatgaacggcttcgatcaccctttcatcttaaccaatcatgat
ttaattaacccggatgttatcttaaaaagtcctactaaagatatcaccttagagatgttc
actgatcaaccttcagttgttattttttcagcaaattttgctgataacggtcctgatatt
caagggcaaaaattagtcaatcacggagcgctcacatttgaaacccaagtctgtcctggt
gctgaaagatttccgttgttcggttctatcaccctctcacctgaacaggaatttcactca
acgacccgtttcaaactaatttattaa

DBGET integrated database retrieval system