KEGG   Enterococcus faecalis D32: EFD32_0879Help
Entry
EFD32_0879        CDS       T02172                                 

Definition
galactose mutarotase (EC:5.1.3.-)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
efd  Enterococcus faecalis D32
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:efd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFD32_0879
   00052 Galactose metabolism
    EFD32_0879
Enzymes [BR:efd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     EFD32_0879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(919493..920539)
Genome map
AA seq 348 aa AA seqDB search
MIILTISTESFGQGMLLYTLTNKNGVTLKATDFGARIVALDVPLTKNESRSLVLGFPSAD
EYLSKDLYFGATIGRTAGRIADGSFELAGKKYQTMINTPTQTTLHGGTPGFESKKWHSEI
QEAQANPSVKFWLESPAGENGFPGNLTVSVTYTLTEENEWQIEYQATTDEQTLFNPTNHV
YFNLTGNPTIPIDAHELQINAQKFVPLDERVLPLGELASVDQTAFDLQKPKKLAEVFSST
DEQIQKMNGFDHPFILTNHDLINPDVILKSPTKDITLEMFTDQPSVVIFSANFADNGPDI
QGQKLVNHGALTFETQVCPGAERFPLFGSITLSPEQEFHSTTRFKLIY
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
ttgattattttgactatttcaactgaatcatttggacaaggaatgcttctttacacactg
acgaataaaaatggtgtgactttaaaagcaacagattttggtgcgcgaattgttgcgctc
gacgttcctcttacaaaaaatgaatcccgatcactcgtgctaggctttccctcagcagat
gaatatttgtctaaagacttatattttggtgcaacaattggtcgaacagctggccgaatt
gccgatggctcctttgaactagcgggtaaaaagtatcaaacgatgattaatactcctact
caaacaacacttcacggtggcacacctgggtttgaaagtaaaaaatggcacagcgaaatc
caagaggcacaagcgaatccttctgtgaaattttggctagagagtcctgctggtgaaaat
ggttttcctggaaatctcactgtttcagtcacgtatacattgactgaagaaaatgaatgg
caaattgagtatcaggcaactacagatgaacaaacacttttcaatccaaccaatcatgtc
tactttaatttaactggaaatcctacaatccccattgatgcgcatgagttacaaataaat
gcccaaaagtttgtcccgcttgatgaaagagttttaccgcttggagaattagcttccgtc
gaccagacagcttttgatttacaaaaacctaaaaaattagctgaggttttttcaagtacc
gatgaacaaattcaaaagatgaacggcttcgatcaccctttcatcttaaccaatcatgat
ttaattaacccggatgttatcttaaaaagtcctactaaagatatcaccttagagatgttc
actgatcaaccttcagttgttattttttcagcaaattttgctgataacggtcctgatatt
caagggcaaaaattagtcaatcacggagcgctcacatttgaaacccaagtctgtcctggt
gctgaaagatttccgttgttcggttctatcaccctctcacctgaacaggaatttcactca
acgacccgtttcaaactaatttattaa

DBGET integrated database retrieval system