KEGG   Enterococcus faecalis D32: EFD32_0976Help
Entry
EFD32_0976        CDS       T02172                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
efd  Enterococcus faecalis D32
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EFD32_0976
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EFD32_0976
Enzymes [BR:efd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     EFD32_0976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1019991..1021283
Genome map
AA seq 430 aa AA seqDB search
MKKIVINGNRPLKGEVTISGAKNSVVALIPAAILADSPVTLDGVPDIQDVHSLIEILEIM
GAKITFENNTLIIDPTEVVSVPMPKGKINSLRASYYFMGSLLGRFGEGVVGLPGGCYLGP
RPIDLHIKGFEALGAHVTNEHGAMYLRTDEAGLQGTRIFMDMVSIGATINVMLAAVKAKG
KTIIENAAREPEIIDIATLLNNMGAKVRGAGTDVIRIEGVEELHGCRHSIIPDRIEAGTY
LAMAAAMGEGIKVRNVIYEHLESFIAKLQEMGVKMTIEEDMIEVHPSHDLKMTTVKTYPY
PGFATDLQQPLTPLLLKAQGTGEIIDTIYAQRNKHIPELVRMGADASVEGNMIILNGPNQ
LHGAEVVASDLRAGACLVTAGLMAEGTTTIYNVEYILRGYDHIIEKLTALGADIQMLETE
EQEGPFEVDQ
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcgtaatcaatgggaatcgtccattaaaaggcgaagtaaccattagcggc
gctaaaaatagtgtggtcgctttaattccagctgctattttagcagattcgcccgtgact
ttagatggcgttcctgacattcaggatgttcactcattaattgaaattttagaaattatg
ggtgctaaaattacttttgaaaataatacattaattattgacccaacagaagttgtttct
gtgccaatgccaaaaggaaaaatcaatagcttacgtgcatcctattattttatgggctca
cttcttggtcgatttggggaaggcgttgtcggcttacctggcggttgttacttaggccct
cgtccaattgatttacatatcaaaggatttgaagcattaggcgctcatgtaaccaacgaa
catggggcgatgtacttgagaacagacgaagctggcttacaaggaacacgaatttttatg
gatatggtatctattggcgctacaatcaatgtcatgttagccgcagttaaagccaaaggc
aaaacgattattgaaaatgctgcgcgtgagccagaaattattgatattgctacattatta
aataacatgggtgcaaaagtccgaggagctggaacggacgttattcggattgaaggtgtc
gaagaattacatggttgtcgtcactcgattattccagatcgaattgaagctgggacttat
ttagctatggcagcagctatgggtgaaggaatcaaagttcgaaatgttatttatgagcat
ttagaaagcttcattgcgaaattgcaagaaatgggcgttaagatgacaattgaagaagac
atgattgaagttcatccgtcacatgatctgaaaatgacgacggtgaaaacctatccgtat
cctggttttgccacagacttgcaacaaccgttaacgccattacttttaaaagcgcaagga
actggtgaaattattgatacgatttatgctcaacgaaataagcatatccctgagttggtg
cggatgggggctgatgcttcggttgaaggcaatatgattatcttaaatggcccaaatcaa
ttgcacggtgcagaagtagtcgcctctgatttacgggcaggcgcttgcctagtcactgcc
ggcttgatggctgaaggtacgaccacgatttataatgtagaatatattttacgtgggtac
gaccacattatcgaaaagttaactgctttgggtgctgatattcaaatgctagaaaccgaa
gaacaagaaggtccgtttgaggtggatcaatga

DBGET integrated database retrieval system