KEGG   Enterococcus faecalis D32: EFD32_1245Help
Entry
EFD32_1245        CDS       T02172                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
efd  Enterococcus faecalis D32
Pathway
efd00010  Glycolysis / Gluconeogenesis
efd00030  Pentose phosphate pathway
efd00051  Fructose and mannose metabolism
efd00680  Methane metabolism
efd01100  Metabolic pathways
efd01110  Biosynthesis of secondary metabolites
efd01120  Microbial metabolism in diverse environments
efd01130  Biosynthesis of antibiotics
efd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:efd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFD32_1245
   00030 Pentose phosphate pathway
    EFD32_1245
   00051 Fructose and mannose metabolism
    EFD32_1245
  Energy metabolism
   00680 Methane metabolism
    EFD32_1245
Enzymes [BR:efd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     EFD32_1245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: AFO44133
Position
complement(1301322..1303202)
Genome map
AA seq 626 aa AA seqDB search
MATLNRDQQIEEIINLEAILNLPKGTEHFVSDLHGEFEAFDHILRNGSGRIREKVQFLFK
QELNAHQMDELCFIIYYPEEKLTLLENESALSYEWWLLTIRRLVEIVRSSSMKYTRSKVR
KALPETYGYILEELIYQYDETTTKNGYYQQIIEKIILLGEAKRFVTELAYLIQRLIIDHL
HVIGDIYDRGPAPDKIMDRLMSYHSLDIQLGNHDMIWLAAYSGSLACLANVVRICARYGN
LDLLEERYAIDLTALKKFSLETYKENPAFAPKKNPYRALTEDEKQVAMRVQQAIAIIQEK
LEGQIIGRRPDFNLAHRLRLDKIQGETITFDECRYTLINSCFQTVSEEQPYQLTREEKQI
IDDLLTQFQSSPRLTKHMRFLMEKASLYLVYNQNLLIHGCLPLNADGTFQAYTFKGHSYS
GKALVDFFQEMLEEAYAQPASTDDYATDCLWYLWCGEGSSLFGKRAMKTFERYFLAEKET
HYEEKNPYYSLRDTVEVCERILDEFEVTGENRHIINGHTPVKRTKGESPIKANGTLLVID
GGFSKSYQTITGIAGYTLLYNSFGLQLTAHKSFSSKETAILNNQDIHSIKQVIDRPLQRL
LVKDTTIGKELLKQSQALQKQMKQNQ
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
ttggctacactgaaccgcgatcaacaaattgaagaaattattaatttggaagcaattttg
aatttaccgaaaggaacagaacattttgtcagtgatttacatggtgaatttgaagctttt
gaccatattttaagaaatggttctgggcgaatccgagaaaaagttcaatttttatttaaa
caagaattaaatgcccatcagatggacgagctttgttttattatctactatccagaagaa
aaattaacacttttagaaaatgaaagcgccctctcttatgaatggtggctattaacgatt
cgccgtctggttgaaatcgtccgttcttcttcgatgaagtacacacgttctaaagttcgc
aaagcccttcctgaaacctatgggtatattctcgaagaattgatttatcaatatgatgaa
acaacaaccaaaaacggttactatcaacaaattattgaaaaaattattttactaggtgaa
gccaaacgtttcgtgacagaattagcttatctaatccaacgtctgattatcgatcaccta
catgttattggggatatctatgaccgggggccagcaccagataaaattatggaccgatta
atgtcctatcactccttggatattcaactaggcaatcatgatatgatttggctggctgct
tatagtggttcactggcttgtttagccaatgtagtacgtatttgtgctcgctatggaaat
ttagatttgttagaagaacgttatgctatcgatttaaccgccttaaaaaaatttagttta
gaaacgtataaagaaaatcctgcttttgcacccaagaaaaatccctatcgtgcgttaact
gaagatgaaaaacaagtagcgatgcgtgtgcaacaagccattgccattattcaagaaaaa
ctagaaggccaaattattggtcgacgccctgattttaacttggcacatcggctacgccta
gataagattcaaggggaaactattacttttgacgaatgtcgttatacattaattaacagc
tgtttccaaaccgtttctgaagagcagccttaccaattaacacgtgaggaaaaacagata
attgatgatttattaacgcaatttcagtcttcaccgcggttaacaaaacacatgcgcttt
ctaatggaaaaagcctctctttaccttgtgtataatcaaaatttattgatccacggctgt
ctgcctctgaatgcggacggtacttttcaagcttatacatttaaaggccactcctattca
ggaaaagctttagttgacttctttcaggaaatgttagaagaagcttatgctcagcctgct
agcacagatgactatgcaacagattgtttatggtatctttggtgtggcgaaggttcctca
ttatttggtaaacgagctatgaaaacctttgagcgttattttctcgctgaaaaagaaaca
cattacgaagaaaagaatccttattactctttgcgtgatacggttgaagtttgtgaaaga
atcctagatgaatttgaagtgactggtgaaaatcgacatatcattaatggccatacacca
gttaaacgaacaaaaggcgaatcgccaatcaaagcaaatggcacgcttctcgtaattgac
ggcggcttttcaaaatcttatcagacaattactgggattgctggttatacattgttgtac
aactcgtttggtttacaactgaccgcgcataaatctttttctagtaaagaaacagccatt
ttaaataatcaagacattcattccatcaaacaagtcatcgatcgccccttacagcggtta
ttggtgaaagataccactatcggcaaagagctattaaagcaatcgcaagcactccaaaaa
caaatgaaacaaaaccagtag

DBGET integrated database retrieval system