KEGG   Enterococcus faecalis D32: EFD32_1345Help
Entry
EFD32_1345        CDS       T02172                                 

Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
efd  Enterococcus faecalis D32
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:efd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFD32_1345
Enzymes [BR:efd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     EFD32_1345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1408430..1409839)
Genome map
AA seq 469 aa AA seqDB search
MVKQFKNDFLWGASSSAFQIEGAWNEDGKGLTVADYNSFKKSAVQADTKVASDFYHHFKE
DIALMKELGLKTYRFSLSWARIIPTGDGEINQAGIDFYNAVIDTLLENDILPFVTLYHFD
LPFALVEKYNGWADRRCVSAFQRYAQVCYQAFGDRVKNWQVTNEQNLMIRVDERMNMYDV
APENAEKIRAQMDYHMFVAHALATNDCHQLVAGGKVGPSVSSTMTYPSSNKPEDVWAARM
NDNFKTNYALEMYCFGEYPGYYQEYLTKCGIYPETQQEDQAILKAAKPDFIALNYYRTLV
ASYLPTDEQHPLGTKEKDIDFDLYGYFKIEKNQHLKTSKYGAQIDPTGLRLVLNDYYRQY
RLPLIITENGLGTPDHLTEDGKVHDDYRIAYLHDHIAACHAAISDGVELFGYCPWSVMDI
LSSHQGFKKRYGFIYVNREDHELKDLRRIKKDSFYWYQSVIKNNGLPEE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggttaaacaatttaagaacgattttttatggggcgcttcttcctccgcttttcaaatt
gagggcgcttggaatgaggacggcaaaggcctaacagttgctgattacaattcttttaaa
aagtcagctgtacaagcagatacgaaagtcgccagcgatttttatcatcatttcaaagag
gacattgcgttaatgaaagaattaggcttaaaaacctatcgtttttctctttcatgggca
cgaatcattccaacaggtgatggcgaaatcaatcaagccggcatcgatttttataatgcc
gtcattgatacacttttagaaaacgatattttgccgtttgtcacactttatcattttgat
ttaccttttgcattggtggaaaaatacaatggttgggcggatcgtcgctgcgtttccgca
tttcaacgctatgcgcaagtttgttatcaagcgtttggtgatcgagtcaaaaattggcaa
gttacaaacgaacaaaacttaatgattcgtgttgatgaacgaatgaatatgtacgatgtt
gcaccagaaaatgctgaaaaaattcgtgcacaaatggattaccatatgtttgttgcccat
gcgttagcgacgaatgattgtcaccaattggtcgctgggggaaaagtcggtccctctgtt
tcctcaacgatgacttatcctagttctaataagcctgaagatgtttgggcggctcgtatg
aatgataactttaaaacgaattacgctctagaaatgtattgttttggcgaatacccaggt
tactatcaagagtatttgaccaaatgcggcatttatcccgaaacacagcaagaagatcaa
gcaattttgaaagccgctaaaccagattttatcgctcttaattattatcggacgttagtc
gctagctatttaccgacagatgagcaacacccattgggtacgaaagaaaaggacattgat
tttgatctatacggttattttaaaatcgaaaaaaatcaacatttaaaaacctctaagtat
ggtgcccaaattgatccaactggtctacgtttagttttaaatgattattatcgtcaatac
cgtttgccattaatcattacagaaaacggtttaggcacacccgatcacctaacagaggac
ggaaaagttcatgatgactatcgaattgcgtatttgcatgatcatattgctgcttgtcat
gcggctatttctgacggtgttgagttgtttggctattgcccttggtcggtcatggatatt
ttaagttctcatcaaggattcaaaaaacgctacggttttatttacgtcaatcgtgaagac
catgagttaaaagatttacgacgcattaaaaaagatagtttttattggtaccaatcagta
attaaaaataatgggttaccagaagaatag

DBGET integrated database retrieval system