KEGG   Enterococcus faecalis D32: EFD32_1479Help
Entry
EFD32_1479        CDS       T02172                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
efd  Enterococcus faecalis D32
Pathway
efd00040  Pentose and glucuronate interconversions
efd00052  Galactose metabolism
efd00500  Starch and sucrose metabolism
efd00520  Amino sugar and nucleotide sugar metabolism
efd01100  Metabolic pathways
efd01130  Biosynthesis of antibiotics
Module
efd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:efd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EFD32_1479
   00052 Galactose metabolism
    EFD32_1479
   00500 Starch and sucrose metabolism
    EFD32_1479
   00520 Amino sugar and nucleotide sugar metabolism
    EFD32_1479
Enzymes [BR:efd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EFD32_1479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AFO44365
Position
complement(1544269..1545165)
Genome map
AA seq 298 aa AA seqDB search
MKVKKAVIPAAGLGTRFLPATKAMAKEMLPIVDKPTIQFIVEEALASGIEDILIVTGKAK
RPIEDHFDSNVELENNLKEKNKTDLLKLVEETTDVNLHFIRQSHPKGLGHAVLQAKAFVG
NEPFVVMLGDDLMEDKVPLTKQLMDDYEETHASTIAVMKVPHEDTSKYGIINPEKEIEKG
LYNVENFVEKPKPEEAPSDLAIIGRYLLTPEIFDVLENQKPGAGNEIQLTDAIDTLNKTQ
RVFAREFKGERYDVGDKFGFMKTSIEYGLTHPEVKDNLREYIINLGAQLAKKEQPKEK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaaaaggcagttattccagcagctgggttaggaacacgtttcttgccggct
accaaagcgatggcaaaagaaatgttaccgattgttgataaaccaacgattcaatttatt
gtagaagaagcactagcttcaggaatcgaagatattttaattgtgacaggcaaagccaaa
cgtccgattgaagatcattttgattcaaatgttgaattagaaaataatttaaaagaaaaa
aataaaaccgatttattgaaattagtcgaagaaacaacggatgttaatttacattttatt
cgtcaatcccatccgaaaggcttaggacacgctgttttacaagcgaaagcatttgttggc
aatgaaccttttgtcgtgatgttaggcgacgatttaatggaagataaagtgccattaacg
aaacaattaatggatgattacgaagaaacacatgcttcgacgattgctgtaatgaaagtg
ccccatgaagatacttcaaaatatggtattatcaacccagaaaaagaaatcgaaaaagga
ctatacaatgtcgagaattttgttgaaaaaccaaaacccgaggaagcaccaagtgattta
gcgattatcggccgttatttattaacccctgaaatttttgatgtacttgaaaatcaaaaa
ccaggcgctggtaacgaaattcagttaacagatgcgattgacactttaaataaaacacaa
cgcgtttttgctcgtgagtttaaaggagaacgttacgacgttggcgataaatttgggttt
atgaaaacaagcattgaatatggtttgactcatccagaagtaaaagataatttacgagaa
tacattattaatttaggtgctcaattagcgaaaaaagagcaaccaaaagaaaaataa

DBGET integrated database retrieval system