KEGG   Enterococcus faecalis D32: EFD32_1583Help
Entry
EFD32_1583        CDS       T02172                                 

Definition
bacterial regulatory protein, LacI family protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
efd  Enterococcus faecalis D32
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:efd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EFD32_1583
Enzymes [BR:efd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     EFD32_1583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1649268..1651181
Genome map
AA seq 637 aa AA seqDB search
MMNIKDIAKLAGVSASTVSKIINNKDQTISKETRERVLKIVRDYNYTPYSANLVTNSTTK
TFVLLLNSHETFEAWVTSFIDKAQENGYNCLILNSHGSLEQELKNITSPTLKQASGIIWD
PINENSKQYAKFIEELTIPYYFVNHSTNELPSLAGLYEEASYVLTQELLQNNHKKISYFV
TNPKYKEAIIAGYKKALFDVNLPFSKENILTTIPADFSNQLITDGITGILTDDYTQAVFL
EQLLKQSGLRTPDNYSLLAIKRKIDRSFLPDHISSVLLDTETFGSQLALLLLNKRKEKTA
LINDAEKLVLDHKNTLGMSSVNPHSKMIVVGSLNVDNYLYSTNLPHNGKTNFLSSYAKFP
GGKGLNQAVGLTKLGHQATLIGCLGSDTDANYLYKELEKYHVTTDGVTRIQDAETGQAYI
YVETSGDSMISILPGANIALTPKKIAQQKHLFMDASFCLIQTEIPLSAVEKACEIAQHSG
VPIILKPAAIHHIPVNILEKVDFFIPNEDELLELQPDTGTLEEKAAYFLEMGVKNVIVTL
GKKGVLLKTPQVCHYFPATENIAVDSTGASDSFISALASYLSKGYPTEAAIQIAIQAAGF
SVSKEGVIDSLVDHVTLENYLIKKEPALFAHRNTCVD
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatattaaagatattgcaaaattagctggcgtttccgcttcaactgtatccaaa
attataaataataaagatcaaactattagtaaagaaacccgtgagcgtgtcttaaaaatc
gttcgagattacaactacacaccttactcagcaaatctcgtcacaaatagtactacaaaa
accttcgtgttattattaaatagccatgaaacttttgaggcttgggttacgagctttatt
gataaagctcaagaaaatggctataactgcttgattttaaatagtcacggtagtttagaa
caagaactgaaaaatattacctcgccaactttaaaacaagccagtggcattatttgggac
ccaatcaatgaaaacagtaaacaatacgcgaaatttatagaagaattaacgattccttat
tattttgtcaatcactcaactaacgaattaccttctctagcggggctttatgaagaagct
agttatgttttaacccaagaattattacagaataaccataaaaaaattagttatttcgtc
actaacccaaaatataaagaagcaattattgcaggctataaaaaagccttgtttgatgtc
aatttaccctttagtaaagaaaatattttaactactatccctgctgatttcagtaatcag
cttatcacagatgggattacgggtatccttactgatgactatacccaggctgtttttttg
gaacagcttttaaagcagagcggtttgcgaacccccgataattactctttactcgcaatt
aagcgaaaaattgatcgttcatttttacctgatcatatttcttccgtcttattagataca
gagacgtttggcagccagttagccttattattgcttaacaaacgcaaagaaaaaacagcc
ttgattaatgacgctgaaaaattggtgctagatcacaaaaatacattaggcatgtctagt
gttaatccacatagcaaaatgattgtagtaggtagtttaaacgttgataattatctgtat
tcaacaaatttaccacataacggcaaaacaaattttttgtctagctatgctaaattcccc
ggcggaaaaggattaaatcaagctgttggcttaaccaaactggggcatcaggccacctta
attggttgtttaggctcagacacagatgcgaattacttatataaagaattagaaaaatac
cacgttacgacagatggtgtcacacgtattcaagatgctgagactggtcaagcttatatt
tatgttgagacaagcggcgactccatgatttcaatcttacctggtgcaaacatagcgctt
acacctaaaaaaatcgcacagcaaaaacacctatttatggatgccagtttttgtctcatt
caaacagaaattcctttgtctgctgtagagaaagcttgtgaaattgcccaacattcaggc
gtaccgattattttaaaaccagctgctattcatcatattccagtgaatatactagaaaag
gttgattttttcattcccaatgaagatgaattattggaacttcaaccagatactggtaca
ttagaagagaaagcggcgtacttcttagaaatgggcgtaaaaaatgtcattgttacttta
ggaaaaaaaggcgtgttattaaaaacaccccaagtgtgccactatttccctgcaacagaa
aatatagctgtggatagcactggtgccagtgacagctttatcagcgcgctcgcctcctat
ctttcgaaaggttatccgactgaagcagccattcaaatagcaattcaggctgcaggattt
tcagtttctaaagaaggggtgattgattctttagttgatcacgtcactttggaaaattat
ttgataaaaaaagaacccgctctttttgctcatcgtaacacctgtgtcgactga

DBGET integrated database retrieval system