KEGG   Enterococcus faecalis D32: EFD32_1590Help
Entry
EFD32_1590        CDS       T02172                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
efd  Enterococcus faecalis D32
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    EFD32_1590
Enzymes [BR:efd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     EFD32_1590
Exosome [BR:efd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EFD32_1590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1657349..1658854)
Genome map
AA seq 501 aa AA seqDB search
MAEEKYIMAIDQGTTSSRAIIFDKKGNKIGSSQKEFTQYFPNAGWVEHNANEIWNSVQSV
IAGSLIESGVKPTDIAGIGITNQRETTVVWDKATGLPIYNAIVWQSRQTTPIADQLKEDG
YSEMIHEKTGLIIDAYFSATKVRWILDHVEGAQERAENGELMFGTIDTWLVWKLTGDTHV
TDYSNASRTMLFNIHDLDWDQEILDLLNIPRVMLPKVVSNSEVYGLTKNYHFYGSEVPIA
GMAGDQQAALFGQMAFEPGMVKNTYGTGSFIVMNTGEEPQLSKNNLLTTIGYGINGKVYY
ALEGSIFVAGSAIQWLRDGLKMLQTAAESEAVAKASTGHNEVYVVPAFTGLGAPYWDSQA
RGAVFGLTRGTTREDFVKATLQAVAYQVRDIIDTMKEDTGIDIPVLKVDGGAANNDFLMQ
FQADILNTAVQRAHNLETTALGAAFLAGLAVGFWKDLEEIKAFQEEGQQFEPIMAEEERE
DLYEGWQQAVAATQQFKRKNK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaaaaatacattatggcgattgatcaaggaacgactagttctcgtgcaatt
atttttgataaaaaaggaaacaaaattggtagttcacaaaaggaatttactcaatatttt
cctaatgcaggctgggtggaacataatgccaatgaaatttggaattctgttcaatccgtt
attgcaggttctttaattgagtcaggagtgaaacctacagatattgccggaattgggatt
acaaaccaacgggaaacaaccgttgtttgggacaaagcaactgggttacccatttataac
gcaattgtttggcaatcacgccaaacgacacctattgctgatcaactaaaagaagatggc
tacagcgaaatgattcatgaaaaaactgggttaatcattgatgcttatttctcagcaacg
aaggttcgttggatcttagatcacgtagaaggtgcgcaagaacgtgcagaaaatggagaa
ttgatgtttgggacaattgacacttggctcgtttggaaattaacgggagatactcatgtc
actgattattcaaatgcaagtcggacgatgttgtttaatatccatgatttagattgggat
caagaaattttggatcttttaaatatcccacgagtgatgttaccgaaagtggtttcgaac
tctgaagtgtatggactaacaaaaaattaccatttttacggaagtgaagtacctatcgct
gggatggctggtgaccaacaagccgctttatttggtcaaatggcctttgaacctgggatg
gttaaaaatacctatggaacaggctcatttattgtcatgaacactggcgaagaacctcaa
ctttctaaaaataatctgcttaccactattggctatggcattaacggcaaagtatattat
gccttggaaggaagtatcttcgtggctggttcagcgattcaatggttacgagatggctta
aaaatgttgcaaacggctgctgaatctgaagcagtagccaaagcgtcaacaggacacaat
gaagtttatgtggttccggcattcactggtttgggcgcaccatattgggattcacaagcg
cgtggggctgtctttggattgacacgtggtaccacgagagaagattttgtcaaagcgaca
cttcaagcagttgcgtatcaagttcgtgacattattgacacgatgaaagaagatacaggc
atagatattcccgtcttaaaagtagacggtggagcagcaaacaatgatttcttgatgcaa
ttccaagcagatattttaaacactgctgttcaaagagcccataacttagaaacaacggcc
ttaggcgcagctttcttggcgggcttagcggttggcttctggaaagacttagaagaaatc
aaagcattccaagaagaaggacaacaatttgaaccaattatggcggaagaagaacgagaa
gatttatatgaaggttggcaacaagcagtagcagctacccaacaattcaaacgtaaaaat
aagtaa

DBGET integrated database retrieval system