KEGG   Enterococcus faecalis D32: EFD32_1618Help
Entry
EFD32_1618        CDS       T02172                                 

Definition
(RefSeq) triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
efd  Enterococcus faecalis D32
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:efd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EFD32_1618
   01230 Biosynthesis of amino acids
    EFD32_1618
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFD32_1618
   00051 Fructose and mannose metabolism
    EFD32_1618
   00562 Inositol phosphate metabolism
    EFD32_1618
Enzymes [BR:efd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EFD32_1618
Exosome [BR:efd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EFD32_1618
  Exosomal proteins of bladder cancer cells
   EFD32_1618
  Exosomal proteins of melanoma cells
   EFD32_1618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1685514..1686269)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTLSEAQSFAEAVKNAVPSNDVVDAVIGSPALFLAPLAWNLKDSEVK
LAAQNCYWENAGAFTGENSPAAIADLGVDYVIIGHSERREYFHETDEDINKKAKAIFANG
MTPIFCCGETLETYEAGKTAEWIEGQITNGLVGLSNEQVASMVIAYEPIWAIGTGKSADA
NIADEICGVVRSTVEKLYGKEVSEAVRIQYGGSVKPENIAEYMAKENVDGALVGGASLEA
DSFLALLDAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaccaattatcgctggtaactggaaaatgaacaaaactttaagcgaagcacaa
agctttgcagaagcagtaaaaaatgctgttccatcaaacgacgttgttgacgctgtgatt
ggatctccagcattattcttagctcctttagcttggaacctaaaagattctgaagtgaaa
ttagctgcacaaaactgctactgggaaaacgctggtgccttcactggtgaaaactcacca
gctgcaattgcagatttaggtgtagactatgtgattatcggacactctgaacgtcgcgaa
tatttccacgaaacagatgaagatatcaataaaaaagccaaagcaatctttgcaaatggt
atgacaccaatcttctgttgtggtgaaactttagaaacgtatgaagctggtaaaacagcg
gaatggatcgaaggtcaaatcactaacggcttagttggtttatcaaacgaacaagttgct
tcaatggttatcgcttacgaaccaatctgggcaatcggaactggtaaatctgcagatgct
aatattgcagatgaaatctgtggtgttgttcgttcaacagttgaaaaattatacggcaaa
gaagtttctgaagctgttcgtattcaatacggtggttctgttaaaccagaaaacatcgct
gaatatatggcaaaagaaaacgttgacggtgctttagtcggcggcgcaagcttagaagca
gattcattcctagctttattagatgctgtaaaataa

DBGET integrated database retrieval system