KEGG   Enterococcus faecalis D32: EFD32_2165Help
Entry
EFD32_2165        CDS       T02172                                 

Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
efd  Enterococcus faecalis D32
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:efd00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2243694..2245139)
Genome map
AA seq 481 aa AA seqDB search
MTTTTKFPKGFLWGGATAANQLEGAYLADGKGLSVADAMPGGKQRFAILGDEAFDWTIDE
TKYRYPNHTGIDHYDRFKEDIALFAKMGFKCYRFSIAWSRIFPQGDETQPNEAGLKFYDA
VIDECLNYNIEPVITISHYEMPLHLAKEYGGWKNRQLVDFYERFAETVLTRYHQKVNYWM
TFNEINSAFHFPALSQGLVKSNGANDYQNIFQAWHNQFVASSKAVKIGHELNPELQIGCM
IIYATTYGIDSNPVNQVATMIENQEFNYYCTDVQVRGEYPAYAERMYQKYAVKDLVIEEG
DLELLKEYPVDYIGFSYYMSTAVDVTGTTNDTANGNLLGGVKNPFLEASEWGWQIDPEGL
RIALNELYNRYQKPLFIVENGLGAIDKVDENFYVADDYRIDYLRRHIEAMAEAVADGVDL
MGYTPWGCIDLVSASTGEMSKRYGFIYVDLDDEGNGTKNRYEKKSFNWYKQVIETNGQNL
D
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaacgacaaaatttccaaaaggatttttatggggcggtgcgaccgcagccaat
caattagaaggggcttatttagccgatggtaaagggttatctgtggcagatgcgatgccg
ggaggaaaacaacgtttcgctattttaggagatgaagcgtttgattggacgattgacgaa
acgaaatatcgctaccctaatcatacaggaattgatcactatgatcgctttaaagaggac
attgcgttgtttgctaaaatgggcttcaaatgttatcgattttcaattgcgtggtcgcgt
atttttccacaaggagatgaaacacaaccgaatgaagccggcttgaaattttatgatgcg
gttatcgatgaatgcttaaactataacattgaaccagtaattacgatttctcattatgaa
atgccactgcatttagcgaaagaatacggcgggtggaaaaatcgccaattagttgacttt
tatgaacgttttgcggaaactgttttaacacgttaccaccaaaaagttaactattggatg
acattcaatgaaattaattcagcgttccatttcccagcacttagtcaaggattggtgaaa
agcaatggagccaatgattatcaaaacattttccaagcatggcataatcaatttgttgca
agtagtaaagctgtaaaaattggccatgaattaaatccagaattacaaattggatgtatg
attatttatgcaacaacgtatggcattgattcgaatccagtcaatcaagttgctacaatg
attgaaaaccaagagtttaattattattgtacagatgttcaagttcgtggtgaatatcca
gcatacgcagaacgcatgtatcaaaaatatgctgtgaaagacttagttattgaagaaggc
gatttagaattattaaaagaatacccagtggattacattggctttagttattatatgtcg
actgctgtcgatgttactggtactaccaacgatacagcaaatgggaatcttttaggcggc
gttaaaaatcccttcttagaagcaagtgaatggggttggcaaattgatcccgaaggctta
cgaattgccctaaatgaattatataatcgttatcaaaaacctttatttattgtggaaaac
ggcttaggtgcaattgataaagtagacgaaaatttctatgtggcagacgactatcggatt
gattatttacgtcgtcatattgaagcaatggcagaagcagttgcagacggcgtcgattta
atgggctatacgccgtggggctgtattgatttagtcagtgcttccacaggtgaaatgagt
aaacggtatgggtttatttacgttgatttagacgatgaaggaaatggtactaaaaaccgt
tatgaaaaaaaatcgtttaattggtacaaacaagttattgaaactaatggacaaaactta
gactag

DBGET integrated database retrieval system