KEGG   Enterococcus faecalis D32: EFD32_2221Help
Entry
EFD32_2221        CDS       T02172                                 

Definition
exodeoxyribonuclease V alpha chain (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
efd  Enterococcus faecalis D32
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:efd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EFD32_2221
Enzymes [BR:efd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     EFD32_2221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2302931..2305540)
Genome map
AA seq 869 aa AA seqDB search
MVTLFGEDEEKAFIVGTVQAIFFENPSNFYKVVLVNVTDTNTDYLEKEIVVTGSFGQVQE
EEPYRFFGHFVDHPRYGRQFQVDSYQQERPTSASGVVNYLSSDKFPGIGKRTAEKIVEVL
GESAIDRIIDDPSVLEEVTVLNEKKRQVIVETIRLNHGMEQVIVGLNRYGFGSQLAFSIY
QTYQEETLSVIQENPYQLVEDIEGVGFKRADNIAEQIGIQADSAVRIRAAILHEVFEHSI
RSGNTYVQADVLLEEAIRTLEASRPVEISPDQVANEIITLVEHGKIQQEETKLFENSLYF
SEWGIGTSIQRLLSRKKEIHYEEEEVQKNIRMIEKRLNIQYGDSQQAAIEEAIKSPLFIL
TGGPGTGKTTVINGIVSLFAELNGLSLDLKDYTQEMFPILLAAPTGRAAKRMNETTGLPA
STIHRLLGLTGREKNPSLTAKELEGGLLIVDEMSMVDTWLANTLLKAIPTNMQVIFVGDK
DQLPSVGPGQVLHDLLQINEIPKCELNEIYRQGDGSSIIPLAHEIKEGKLPADFQKNQKD
RSFFASDIGHIEEYIRQIVTKAKAKGFTPQDIQVLAPMYRGAAGIDALNKMMQEIFNPND
GKKKEVKWNDTVYRIGDKVLQLVNTPELNVFNGDMGEIVGITLAKDSEDKVDELVLQFDN
NEVTYKRNEWNKITLSYCCSIHKAQGSEFRMVLLPMVHQYSRMLQRNLLYTAVTRSKELL
ILLGEVSAFETCVKNESASRMTMLKERIVNAEQMTLTTRTQLEAYEEGLTADHPFTEKET
KAVSYETEQQSTKANQIKETDEQLVDTMVQEVSLFADEGEESTPETANKATKVVEEPLPK
EPRLTVEIIQTNAVDPMIGMKDTTPYQFM
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
gtggtaacactttttggtgaggacgaagaaaaagcctttattgttggaactgtacaagca
atcttttttgaaaatcccagtaatttttataaagtcgttcttgtaaatgtgaccgataca
aatacagattatttagaaaaagaaattgtagtaactggtagttttggccaagttcaagaa
gaggaaccctatcgtttctttggtcattttgtggaccatcctcgttatggcagacagttt
caggtggatagttatcagcaagaaagaccgacttcggctagtggggtggttaactattta
tcaagtgacaaatttcctggcattggtaaacgaactgctgaaaaaattgttgaagtatta
ggggaaagtgcgattgaccgaattattgatgatccgagtgttttggaagaagttactgtt
ttaaatgaaaaaaaacgtcaagtaatcgtcgaaacaattcgcttgaatcacgggatggag
caagtgattgtgggactaaatcgatacggcttcggtagtcagttagctttttcaatttat
caaacctatcaagaagaaaccctttctgtgattcaagaaaatccttatcagttagttgaa
gatattgagggagtcggatttaaacgagcggacaatattgctgaacaaatcggcattcag
gcggattctgctgttcgaattcgagcggcgattttacatgaagtgtttgagcactccatt
cgctcaggcaatacgtatgttcaagcagatgttttgttagaagaagcgattcggaccttg
gaagcaagtcgcccagtggaaatctcacctgatcaagtggctaatgaaatcattacgtta
gtcgaacatggaaaaatccaacaagaagagactaaactttttgagaacagtctctatttt
tctgaatggggcattggtacttcgattcagcgtttactttctcgtaaaaaagaaattcat
tatgaggaagaagaagtccaaaaaaatatccgaatgattgagaaacgtttaaatattcag
tatggcgactcgcaacaagcagcgattgaagaagcgattaaatcgccgttatttatttta
actggagggcccggaacagggaaaacaactgttattaatgggattgtctcgttgtttgcg
gagctaaatggtctttcattagatctcaaagactatacgcaggagatgtttccaatcttg
ctagcggcgccaactgggcgagcagcgaaacgtatgaacgaaacgacaggtttacctgca
agtaccatccatcgtttgttaggcttgacaggtcgtgaaaaaaatccgagtttaaccgcc
aaagaattagaaggtggtttgctaattgtagatgaaatgtccatggtagatacttggtta
gccaatacgttattaaaagctattccgacaaacatgcaagtgatttttgttggtgataag
gatcagctaccgtctgtcggtccaggtcaagtcttacatgacttattgcaaattaacgaa
attcccaaatgtgagttaaacgaaatttatcgtcaaggagacggttcaagtattattcct
cttgcccatgaaattaaagaaggaaagttgcctgctgattttcaaaaaaatcaaaaggat
cgctcgttctttgcaagtgatattggtcatatcgaagaatacattcgacaaatcgtcaca
aaggcaaaagcaaaagggtttacgccacaagatatccaagttttagcgccaatgtatcgt
ggcgcagccggcattgatgccttgaataagatgatgcaagaaatcttcaatccaaatgat
ggtaagaaaaaagaagtcaaatggaatgacaccgtctatcggattggggacaaagttttg
caactagtcaatacgccagaattaaatgtgttcaatggagatatgggagaaatcgtcgga
attactttagccaaagactcagaggacaaagtggacgagttggttttacagtttgataat
aatgaagtaacgtataaaagaaatgaatggaataaaattacgttatcctattgttgttcg
attcataaagcgcaaggtagtgaattccgcatggtgttactgccaatggttcatcagtat
agccgaatgctgcaacgaaatttgctgtatacagcagtgacacgtagtaaagaattatta
attctattaggtgaggtttctgcttttgaaacatgtgtcaaaaacgaatcggctagtcgc
atgacgatgctaaaagaacgaatcgtgaatgcagaacaaatgaccttaacgactagaacc
cagttagaagcctatgaagaaggtttaacggcagaccatccatttactgaaaaggaaaca
aaagctgtctcttatgaaactgaacagcaatcaacgaaagccaatcagataaaagaaaca
gacgagcaattagttgacacaatggtacaagaagtttcactatttgctgatgaaggggaa
gagtcaaccccagaaacagcaaataaagcgacaaaagttgtcgaagaaccattaccaaaa
gaaccacgactaacagtcgaaattattcaaacaaatgctgttgatccaatgattggaatg
aaggatacgacgccttatcaatttatgtga

DBGET integrated database retrieval system