KEGG   Enterococcus faecalis D32: EFD32_2328Help
Entry
EFD32_2328        CDS       T02172                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
efd  Enterococcus faecalis D32
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    EFD32_2328
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    EFD32_2328
Enzymes [BR:efd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     EFD32_2328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2391822..2394899)
Genome map
AA seq 1025 aa AA seqDB search
MKTWENYKVDSINRLPGRAHFSSFPSKETALLNENKYTQAYKNLNGCWHFLFLEAPEYSP
ENFFATDFDTSQMDQITVPGNWQVQGYGKMHYSDLWYNFPINPPYVPTENPTGIYKRTFA
IDETFHDKKIILRFCGVDSAYHVWVNGHEVGYSKGARNEAEFDITSYAKIGETNDLTVRV
YQWSDGTYLEDQDMWWLSGIFRDVELLGVPENGLEDFFIISDLDDSYQNGHLAITGKFWQ
DKGQQVQLELMDQQGKTVLKETVAGNQGTVEFSASLPSVTAWSAEKPYLYQLFITVFSEG
EVVEVIPQKVGFRNIHVSGETFLVNGVAIKLKGMNRHDYNPKNGRVVSREEIEKDIRLMK
QFNINAIRTSHYPASAYFYDLCDEYGMYVIDETDLECHGFELTGEYDWISNDPEWETAYV
SRMVRMIQRDKNHPSILFWSLGNESAFGHNFIEMARIAKEMDPTRLVHYEGDFEAEVTDV
YSTMYTWLEHPTRELLMNTIIENSKKPHILCEYCHAMGNGPGNLKEYQELFYAHDKLQGG
FIWEWFDHGIESVTDNGEVYYRYGGDFGDDPSNKDFCIDGMLMPDRTPSPSLYEYKKVIE
PITTSAIDVLSGEFSLLSRFDFENLAIFNLVYTITEDQTVIQSGTVSVPAIAAREEGRLH
LPYHLDFPKKAGAAYYLTLSYQLKETTAYASAGHELATAQFELPITTPGIEITPVGLLMA
KEIGPHLYIEGPNFSINFDKVKGALTNVTRDGKKLLHKGPKFTFWRAPISNDMEIIDEMK
KKYFLHLEHEIVRSFEWKKVDDFIQVIVKTINGTTNSAWHYQCTYQYLIAPNGEIFFDLK
GSPAGKIENAPDMLPRLGVTLHLDKSLSEVKYFGKGPRENYVDSQEAGLLGVYEATVAEM
FTNYVVPQANGNHMATKWSAFTDDRGQGVVATAADSYNFSVSYFEEQTLDVAKHTNELQE
SEYVVLNIDYKQNALGSYSCGQWQLEKYRTTFEEFQLAFRLTPFNNKEIQAADVAHERVK
RPTIS
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgaagacttgggaaaattataaagtagatagtatcaatcggttgcctggacgagcacat
ttttcgagctttccttcgaaagaaacagcgttattaaatgaaaataaatatacacaagca
tacaaaaatttaaacggatgctggcattttctctttttagaagcgccagaatacagccca
gaaaacttttttgcgacggactttgatacaagccaaatggatcaaatcactgttcctgga
aattggcaagtccaaggatatggcaaaatgcattactctgatttatggtacaattttccc
attaatccgccgtatgtaccaacggaaaacccaacaggtatttacaaacggacatttgct
atagatgaaacatttcacgataaaaaaatcattttacgtttttgtggcgtagattcagct
tatcatgtttgggtgaacggccatgaagttggctacagtaaaggtgcacgaaatgaagca
gaatttgacattacgtcttacgctaaaattggtgaaacaaatgatttaacggtgcgagtc
tatcaatggtcagatggtacgtatttagaggatcaagatatgtggtggttaagtggtatt
tttcgtgatgttgaattactcggtgtaccagaaaatgggctggaagatttctttattatt
tccgatttagatgattcgtatcaaaatggccacttggcaattacgggtaaattttggcaa
gacaaaggacaacaagttcaattggagttgatggatcagcagggaaaaacggttcttaaa
gagactgtcgcaggaaatcaaggtacggttgaattttcagcaagtttaccgtctgtcact
gcttggtcagctgaaaaaccatacttgtatcaactatttatcactgttttttctgaaggg
gaagtcgtcgaagttattccgcaaaaagttggtttcagaaatattcatgtatctggtgag
actttcttagtcaatggtgtggccattaaactaaaaggaatgaatcgtcatgattataat
ccgaaaaatggtcgagtggttagtcgtgaagaaattgaaaaagatattcgtttaatgaaa
caatttaatattaatgccattcgaaccagtcattatccagcatctgcttatttttatgat
ttatgcgatgaatatggaatgtatgtgattgatgaaactgatttggaatgtcacggcttt
gaattaaccggagaatatgattggattagcaacgatccagaatgggaaacggcttatgtt
tctcggatggtacggatgattcaacgggataaaaaccatccatcaattctcttttggtcg
ttaggaaatgaatctgcgtttggtcataactttattgaaatggcccgtattgcaaaagaa
atggatccaacacgtttggttcattatgaaggtgattttgaggcagaggtcacggatgtc
tattctacaatgtatacgtggttggaacacccaactagagaattactgatgaatacgatt
attgaaaattcaaaaaaaccgcatattttatgtgaatattgtcatgcgatggggaatggc
cctgggaatttaaaagaataccaagagctattttatgctcatgataaattacaaggtggc
tttatttgggaatggtttgaccatggcattgaatcggtaacagataacggtgaagtttat
tatcgttatggcggcgatttcggcgatgatccaagtaacaaagatttttgtattgacggg
atgttgatgcctgaccgtacgccatctcctagcttgtatgaatacaaaaaagtcattgaa
cccattacaactagcgctattgacgttctgtcaggtgaattctcattattgagtcggttt
gactttgaaaacttggctatctttaatctggtttatacaattactgaagatcaaacagtg
attcaatcagggacagtatcagtgccagcaattgctgctagagaagaaggaagactgcac
ttaccttatcatttagattttcctaaaaaggcaggagccgcctattatttaactctttca
tatcaattgaaagaaacgaccgcctatgcatctgctggtcatgaattagctaccgcacag
tttgaattgccaattacaacaccagggattgagatcacaccagttggcttgctaatggca
aaggaaattggccctcatttatacattgaaggaccaaacttttcaattaattttgataaa
gtgaagggtgccttaacgaatgtgacacgagatggtaaaaaattattgcataaagggccg
aaatttacattttggcgggcaccgatcagtaatgatatggaaattattgatgaaatgaag
aagaaatatttcttacatttagagcatgaaattgtccgttcttttgagtggaaaaaagtt
gatgattttatccaagtcatcgtaaaaacaattaacggaacgactaacagtgcttggcat
tatcaatgtacctatcagtatttaattgcaccaaatggcgaaattttcttcgacttaaaa
ggtagtcctgctggtaaaattgaaaatgcgccagatatgttaccacgtttgggtgtgact
ctccatttagacaagtctctatcagaagtaaaatatttcggtaaagggccgagagaaaac
tatgtagattcacaagaagctggtttacttggcgtttatgaggctacagtggcggaaatg
ttcactaattatgttgttccacaagccaatggtaaccacatggcgactaaatggtccgca
ttcacggatgatcgcggccaaggggtagtagcaacagcggctgattcatataattttagt
gtttcttattttgaagaacaaacgctagatgttgctaagcataccaatgaattacaagaa
agtgagtatgttgttttaaatatcgattacaaacaaaacgccctaggtagctactcttgt
ggccagtggcaattagaaaaataccggactacgtttgaagaattccaattggcattccgc
ttaacaccttttaataataaagagattcaagcagcggatgtcgcacatgaacgagtaaaa
cgaccaacaatttcttaa

DBGET integrated database retrieval system