KEGG   Enterococcus faecalis D32: EFD32_2380Help
Entry
EFD32_2380        CDS       T02172                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
efd  Enterococcus faecalis D32
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:efd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EFD32_2380
DNA repair and recombination proteins [BR:efd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      EFD32_2380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2444483..2445079)
Genome map
AA seq 198 aa AA seqDB search
MNYPEPIAKLIESYMKLPGIGQKTATRLAFYTIDMKEEDANAFAKALISVKRDLHFCSIC
GNITEEDPCEICQDKNRDRSIILVVEEPKDVMAMEKMREYQGLYHVLHGVLSPMEGTGPE
DINIASLIKRLHDDEVKEVIIATNATTEGEATAMYLSRLIKPAGITVTRLAHGLSVGSDI
EYADEITLLKAVEGRREI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaattatccagaaccgattgcaaaattgattgaaagttatatgaaattaccaggaatt
ggtcaaaaaacagcgacacggcttgctttttatacaattgatatgaaagaagaagatgct
aatgcttttgcaaaagcgctaattagtgtcaagagagatctccatttctgtagtatttgc
ggaaatattactgaagaagatccttgtgaaatttgccaagataaaaatcgtgaccgtagt
attattttagtagtggaagaaccaaaagacgttatggcaatggaaaaaatgcgtgaatat
caaggcttgtatcacgtactccacggggtgctttcaccgatggaaggaacaggaccagaa
gatattaatattgcctctttgatcaaacgattgcacgatgatgaagtgaaagaggtcatt
atagcaaccaacgctaccactgaaggagaagcgacggcgatgtatttatcacggctcatt
aaaccagctggaatcaccgttactcgtttggcacacggcttgtctgtcggcagcgatatt
gaatatgcagacgaaataaccttgctaaaagcagtcgaagggcgtcgagaaatttaa

DBGET integrated database retrieval system