KEGG   Enterococcus faecalis D32: EFD32_2401Help
Entry
EFD32_2401        CDS       T02172                                 

Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
efd  Enterococcus faecalis D32
Pathway
efd00010  Glycolysis / Gluconeogenesis
efd00052  Galactose metabolism
efd00500  Starch and sucrose metabolism
efd00520  Amino sugar and nucleotide sugar metabolism
efd00521  Streptomycin biosynthesis
efd01100  Metabolic pathways
efd01110  Biosynthesis of secondary metabolites
efd01120  Microbial metabolism in diverse environments
efd01130  Biosynthesis of antibiotics
efd01200  Carbon metabolism
Module
efd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
efd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:efd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFD32_2401
   00052 Galactose metabolism
    EFD32_2401
   00500 Starch and sucrose metabolism
    EFD32_2401
   00520 Amino sugar and nucleotide sugar metabolism
    EFD32_2401
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EFD32_2401
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    EFD32_2401
Enzymes [BR:efd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     EFD32_2401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase FGGY_N
Motif
Other DBs
NCBI-ProteinID: AFO45283
Structure
PDB: 

Jmol
Position
complement(2463862..2464833)
Genome map
AA seq 323 aa AA seqDB search
MDKKIIGIDLGGTTIKFAILTTDGVVQQKWSIETNILEDGKHIVPSIIESIRHRIDLYNM
KKEDFVGIGMGTPGSVDIEKGTVVGAYNLNWTTVQPVKEQIESALGIPFALDNDANVAAL
GERWKGAGENNPDVIFITLGTGVGGGIVAAGELLHGVAGCAGEVGHVTVDPNGFDCTCGK
RGCLETVSSATGVVRVARHLSEEFAGDSELKQAIDDGQDVSSKDVFEFAEKGDHFALMVV
DRVCFYLGLATGNLGNTLNPDSVVIGGGVSAAGEFLRSRVEKYFQEFTFPQVRNSTKIKL
AELGNEAGVIGAASLALQFSKEK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggataagaagattattgggattgatttaggtggaacgaccatcaaatttgctatttta
acaaccgatggcgttgttcaacaaaaatggagtattgaaacgaatattttagaagatggc
aagcatattgtgccatcaattattgaaagtattcgtcaccgtatagatctttataatatg
aaaaaagaagattttgtaggaattggtatgggaacaccaggaagtgtcgacattgaaaaa
ggaactgttgtaggtgcctataatttaaactggacgactgtacagcctgtcaaagaacaa
atcgaatctgctttaggaattccgtttgccttagataatgatgccaatgttgccgcttta
ggtgagcgttggaaaggcgcgggggaaaacaatcccgacgtgatttttattactttagga
acaggtgtcggcggaggcattgttgcagcgggagaattgctccacggtgttgctggctgt
gctggtgaagttgggcatgtgacggttgatcctaacggctttgactgtacctgtgggaaa
cgtggctgtttagaaactgtttctagtgccactggtgtcgttcgtgttgcacgtcattta
tcagaagaatttgcaggtgactctgaactgaaacaagcgattgatgatggacaagatgtt
tcgagtaaagatgtttttgaatttgctgaaaaaggcgatcattttgctttaatggttgtg
gatcgtgtttgtttctatttaggcttagccacaggaaacttaggtaacacgttaaatcca
gatagcgtggttatcggtggaggtgtttctgcagcaggagaatttttacgtagtcgtgtc
gaaaaatatttccaagaatttactttcccacaagttcgaaatagtacaaaaatcaaatta
gcagagctaggtaatgaggccggcgtcattggtgccgcttcactagcattacaattttca
aaagagaaatag

DBGET integrated database retrieval system