KEGG   Enterococcus faecalis D32: EFD32_2703Help
Entry
EFD32_2703        CDS       T02172                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
efd  Enterococcus faecalis D32
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:efd00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2769793..2770407)
Genome map
AA seq 204 aa AA seqDB search
MSERGLLIVLSGPSGVGKGTVRKAIFDSEENDFQYSISMTTRKQREGEVDGVDYYFRSRE
EFEAMIEAGEMLEYAEYVGNYYGTPLTYVNQTLDEGKDVFLEIEVQGAKQVKDKVPDGVF
IFLTPPDLAELKSRIIGRGTDEMSVIEERMAVAREEIEMMALYDYAVVNDEVPLAVQRIK
DIIASEHFRVDRVIGKYIKMLEEM
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcgcgggttattaatcgtattgtcaggtccttcaggagtggggaaagggact
gtaagaaaggctattttcgacagtgaagaaaatgattttcaatattcaatctcaatgacc
actcggaaacagcgagaaggcgaagtggatggagtagattactatttccgttcaagagaa
gaatttgaagcgatgattgaagctggagaaatgttggaatatgcggaatatgttggtaac
tattatgggacaccattaacgtatgttaaccagacgctagatgaaggcaaagacgtcttt
ttagaaatcgaagtccaaggggctaaacaagtcaaagacaaagtgcctgatggcgtattt
atctttttgacaccccccgatttagcggaattaaaatcaagaattattggccgcggaaca
gacgaaatgtctgtgattgaagaacgaatggctgtggccagagaagaaatcgaaatgatg
gcgctgtatgattatgcggtagtgaatgatgaagttcctttagccgtgcaacgaattaaa
gacattatcgcgagtgagcacttccgtgttgaccgtgtaattggaaaatatattaaaatg
ttagaggagatgtag

DBGET integrated database retrieval system