KEGG   Enterococcus faecalis D32: EFD32_2750Help
Entry
EFD32_2750        CDS       T02172                                 

Definition
peptidase, ArgE/DapE family protein (EC:3.4.-.-)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
efd  Enterococcus faecalis D32
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:efd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EFD32_2750
  Amino acid metabolism
   00300 Lysine biosynthesis
    EFD32_2750
Enzymes [BR:efd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     EFD32_2750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2817634..2818770)
Genome map
AA seq 378 aa AA seqDB search
MEKSEKISILQDVVKIKSVNGNEEEVAIYLQNLLKKYEIPSELVSYAPNRSSLVAYLGEN
REKVLGFSGHMDVVSEGDESQWTFPPFAAHIEGNKLYGRGSTDMKSGLVAMVLAMIELKE
KEVPLNGAVKFLGTVGEEVGELGAGQLTEKGYADDLSALVIGEPTNYNLMYAHMGSINYS
VVSHGKEAHSSMPEEGINAINNLNEFITAANQQMAEVTANYENPELGRTIHNVTVIKGGT
QVNSIPGQAALQGNIRSIPEFSNDQVIALLQKIVDELNKKEKHQLELTIDYNKIPVKAEK
DSALIQAIQAQFDQPLPLVTSAGTTDLAEFTKSDNTFDCVVFGPGVTTTAHQVDEYVEID
NYLDMIDKYQAIAKSYLN
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatcagaaaaaattagtattttacaagatgtggttaaaattaaatctgtaaat
ggaaacgaagaagaagtggcaatctatttacaaaatcttttgaagaaatatgagatccct
tctgaacttgtttcttatgcaccaaatcgtagtagtttggttgcttatttaggtgaaaac
cgagaaaaagtcttagggtttagtggccacatggacgtggtttctgaaggggacgaaagt
caatggactttcccgccatttgcggcccatattgaaggaaataaattgtatggccgtggc
tcaacggacatgaaaagcggcttagtcgcaatggttttagcaatgattgaattaaaagaa
aaggaagttccattaaatggagcggttaaatttttaggtacagttggtgaagaagtcggt
gagctaggtgctggccaattaactgaaaaaggctatgcggatgatttaagtgccttagtc
attggagaaccaaccaattataacttgatgtatgcgcacatgggttcaattaactattct
gttgtgtcacacggaaaagaagcccacagttcgatgccggaagaaggcattaatgcaatt
aataatttgaacgaatttattacagcagcaaaccaacaaatggcggaagtcacagcaaac
tatgaaaatcctgaattaggtcgaacgattcacaatgtaaccgtcattaaaggtggcaca
caagtgaacagtattccaggtcaagcagccttgcaagggaatatccgttcaattccagaa
ttcagcaacgaccaagtcattgcattattacaaaaaattgtcgatgaattgaacaaaaaa
gaaaaacatcagttagaattaacgattgattacaataaaattcctgtaaaagctgagaaa
gattctgcattaattcaagccattcaagcccaatttgatcaaccattaccattagtgaca
agcgctgggaccacagacttagctgaatttactaaatcagacaatacatttgattgcgtt
gtctttggaccaggtgtgaccactactgcacaccaagtcgacgaatatgtcgaaattgat
aattatttagatatgattgataagtatcaagcgatagcaaaaagttatttaaattaa

DBGET integrated database retrieval system