KEGG   Enterococcus faecalis D32: EFD32_2813Help
Entry
EFD32_2813        CDS       T02172                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
efd  Enterococcus faecalis D32
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:efd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EFD32_2813
Enzymes [BR:efd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     EFD32_2813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2897594..2898385)
Genome map
AA seq 263 aa AA seqDB search
MIDLKKNYQIMGIVNTTPDSFSDGGSYTTVDVAYQHALHLLEAGADILDIGGQSTRPGYE
EVSPQVEADRVLPLIKKIRETSLAPISVDTYYPEVAEAAIQAGATMINDIKGLDTPGMAE
VLAQYPEVQVVIMHSRKRQSLSLKEELHQFYTEKIEQCQKYGLSLEKICFDPGIGFHKTV
AENLQLLKDPNAFRYQDYPLLYGVSRKRTIGALTNEPEPANRDFGSAAASLYAAQQGVEI
LRVHNVQGLKQTFDVWRALSEKE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttaaaaaagaattaccaaattatggggattgtcaacacgacccccgactct
ttttctgatggcggtagctacacaacggtcgacgtggcctatcaacatgcgcttcatcta
ctagaagcgggggccgatattttagacattggcggccaatccacacgtcctggctacgaa
gaagtttctccacaagttgaggcagaccgagtattaccgttaattaaaaaaatacgtgag
acttctctagcgccgatttctgtggatacctactatcccgaagtagcagaagccgcgatc
caagctggcgccacaatgattaatgacatcaaaggattagacactccggggatggcagaa
gtcctcgcacaatatcctgaagtccaagttgtgattatgcattctagaaaacgccaatcg
ctttctttaaaagaagagttgcaccaattttatacagaaaaaattgaacaatgccaaaaa
tatgggctttccttagaaaaaatttgtttcgatccagggattggctttcataaaactgtc
gcagaaaaccttcaactgttaaaagatcctaacgcctttcgctaccaagattatccgtta
ctgtacggcgtttctcgcaaacgaactattggcgctttaacgaacgaaccagaaccagcc
aaccgtgattttggttcagccgctgcttccttgtatgcagcacaacaaggcgtagaaatt
ttacgtgttcataatgtccaaggcttaaaacaaacatttgatgtctggcgagcattgtcg
gagaaggagtaa

DBGET integrated database retrieval system