KEGG   Enterococcus faecalis D32: EFD32_2815Help
Entry
EFD32_2815        CDS       T02172                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
efd  Enterococcus faecalis D32
Pathway
efd00790  Folate biosynthesis
efd01100  Metabolic pathways
Module
efd_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:efd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EFD32_2815
Enzymes [BR:efd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     EFD32_2815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: AFO45695
Position
complement(2898975..2899535)
Genome map
AA seq 186 aa AA seqDB search
MEQEKQAQIEQAVTTILEAVGEDTQRSGLIDTPKRVAKMYAEVFSGLTEPEFDDYKLFDS
LNEGEMVLVKDIAFYSMCEHHLLPFYGKVHVAYLPEGGKVLGLSKLPRLVEHCAKRPTVQ
EDLTVTIARKLQENIPVKGIAVAIEAEHMCMTMRGVKTPQSSTKTFQFTGLFKEQEWKNQ
FLMEIR
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggagcaggaaaaacaagcgcaaattgagcaggcagttaccacaatcttagaagcagtg
ggggaagatactcaacgatcaggactcattgatacccccaaacgtgtagctaaaatgtat
gcagaagtttttagtggattaaccgaacctgaatttgatgattataaattatttgatagc
ttaaatgaaggcgaaatggttctagtaaaagatattgccttttattcaatgtgtgaacac
catttattgccattttatggaaaagtacatgtcgcttatctgccagaaggtggcaaagta
ttgggactaagcaagttaccaagattagtagaacattgtgccaaacgtcccacagttcaa
gaagatttaacagtgacaattgcccgcaaactccaagaaaatattcccgtcaaaggcatt
gcagtagccattgaagcggaacatatgtgtatgacgatgcgcggcgtgaaaacaccacaa
agtagcaccaaaacatttcaatttaccggactatttaaagaacaagagtggaaaaatcaa
tttttaatggagatacgttag

DBGET integrated database retrieval system