KEGG   Escherichia fergusonii: EFER_0431Help
Entry
EFER_0431         CDS       T00811                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
efe  Escherichia fergusonii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EFER_0431
   01230 Biosynthesis of amino acids
    EFER_0431
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFER_0431
   00051 Fructose and mannose metabolism
    EFER_0431
   00562 Inositol phosphate metabolism
    EFER_0431
Enzymes [BR:efe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EFER_0431
Exosome [BR:efe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EFER_0431
  Exosomal proteins of bladder cancer cells
   EFER_0431
  Exosomal proteins of melanoma cells
   EFER_0431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
442697..443488
Genome map
AA seq 263 aa AA seqDB search
MAVNLTLGVSLKMYFGYAQTLDWSRQVAEIVRQHPLLKAYPQTTLFTFPSAPVIDGTLGA
FAGTAMQVGAQNIAPAAPGAWTGETSAAMVAEMGGRFAEIGHAERRRHFHEDDAVICRKV
QLALENGLTPVICIGEPQQLPVADATDFAIQEANVIIHFLQQLGLSGDLIFAWEPQWAIG
APQPASAEYIQSVCAGLRSYLSTVAGHHRVIYGGSAGPGLLSELWPDVDGLFLGRFAHQP
AAIAAILDEAYTLLTRSETKEHL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgaacctcactctcggcgtgagcctgaaaatgtatttcggttatgcgcaaacc
cttgactggagtcggcaggtagcggaaatcgtgcggcaacatccgctgttaaaagcatac
ccgcaaaccaccttatttacctttccctctgcgccggtcattgacggtacactgggcgcg
ttcgctggtacggcaatgcaggttggagcgcagaatattgcccccgcagcgcctggcgcc
tggactggagaaaccagtgcggcgatggttgccgaaatgggcgggcgatttgccgaaatt
ggtcacgctgaacggcgtcgtcattttcatgaggatgacgcggtaatttgccgcaaagtg
cagttggcgctggaaaacggcctgacgccggttatctgtatcggtgagccgcagcaactg
cctgttgctgatgccaccgacttcgccattcaggaggcgaacgtcatcattcactttctg
caacagcttgggcttagcggggatttgatttttgcctgggagccgcagtgggccataggc
gcgccgcagcctgccagcgcagaatatatccagtccgtctgtgcgggactgcgcagttat
ttgtctactgttgcgggtcatcaccgcgtgatttacggtggcagcgccggaccggggtta
ctgagcgagctgtggccggatgtcgatggcctgttcctcgggcgtttcgcccatcagcct
gctgcaatagcggcgatcctggatgaggcctataccctgttaacgcgcagcgagacgaag
gagcatctgtga

DBGET integrated database retrieval system