KEGG   Escherichia fergusonii: EFER_0431Help
Entry
EFER_0431         CDS       T00811                                 

Definition
(GenBank) putative triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
efe  Escherichia fergusonii
Pathway
efe00010  Glycolysis / Gluconeogenesis
efe00051  Fructose and mannose metabolism
efe00562  Inositol phosphate metabolism
efe01100  Metabolic pathways
efe01110  Biosynthesis of secondary metabolites
efe01120  Microbial metabolism in diverse environments
efe01130  Biosynthesis of antibiotics
efe01200  Carbon metabolism
efe01230  Biosynthesis of amino acids
Module
efe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
efe_M00002  Glycolysis, core module involving three-carbon compounds
efe_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFER_0431
   00051 Fructose and mannose metabolism
    EFER_0431
   00562 Inositol phosphate metabolism
    EFER_0431
Enzymes [BR:efe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EFER_0431
Exosome [BR:efe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EFER_0431
  Exosomal proteins of bladder cancer cells
   EFER_0431
  Exosomal proteins of melanoma cells
   EFER_0431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAQ87991
UniProt: B7LT28
Position
442697..443488
Genome map
AA seq 263 aa AA seqDB search
MAVNLTLGVSLKMYFGYAQTLDWSRQVAEIVRQHPLLKAYPQTTLFTFPSAPVIDGTLGA
FAGTAMQVGAQNIAPAAPGAWTGETSAAMVAEMGGRFAEIGHAERRRHFHEDDAVICRKV
QLALENGLTPVICIGEPQQLPVADATDFAIQEANVIIHFLQQLGLSGDLIFAWEPQWAIG
APQPASAEYIQSVCAGLRSYLSTVAGHHRVIYGGSAGPGLLSELWPDVDGLFLGRFAHQP
AAIAAILDEAYTLLTRSETKEHL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgaacctcactctcggcgtgagcctgaaaatgtatttcggttatgcgcaaacc
cttgactggagtcggcaggtagcggaaatcgtgcggcaacatccgctgttaaaagcatac
ccgcaaaccaccttatttacctttccctctgcgccggtcattgacggtacactgggcgcg
ttcgctggtacggcaatgcaggttggagcgcagaatattgcccccgcagcgcctggcgcc
tggactggagaaaccagtgcggcgatggttgccgaaatgggcgggcgatttgccgaaatt
ggtcacgctgaacggcgtcgtcattttcatgaggatgacgcggtaatttgccgcaaagtg
cagttggcgctggaaaacggcctgacgccggttatctgtatcggtgagccgcagcaactg
cctgttgctgatgccaccgacttcgccattcaggaggcgaacgtcatcattcactttctg
caacagcttgggcttagcggggatttgatttttgcctgggagccgcagtgggccataggc
gcgccgcagcctgccagcgcagaatatatccagtccgtctgtgcgggactgcgcagttat
ttgtctactgttgcgggtcatcaccgcgtgatttacggtggcagcgccggaccggggtta
ctgagcgagctgtggccggatgtcgatggcctgttcctcgggcgtttcgcccatcagcct
gctgcaatagcggcgatcctggatgaggcctataccctgttaacgcgcagcgagacgaag
gagcatctgtga

DBGET integrated database retrieval system