KEGG   Escherichia fergusonii: EFER_0780Help
Entry
EFER_0780         CDS       T00811                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
efe  Escherichia fergusonii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EFER_0780 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFER_0780 (glk)
   00052 Galactose metabolism
    EFER_0780 (glk)
   00500 Starch and sucrose metabolism
    EFER_0780 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    EFER_0780 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EFER_0780 (glk)
   00524 Butirosin and neomycin biosynthesis
    EFER_0780 (glk)
Enzymes [BR:efe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     EFER_0780 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
796261..797226
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHNVEVQDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEGIILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgcattagtcggtgatgtgggcggcaccaacgcacgtcttgctctgtgt
gatattgccagtggtgaaatctcgcaggctaagacctattcagggcttgattacccgagc
ctcgaagcggttattcgcgtttatcttgaagaacataatgtcgaggtgcaagacggctgt
atcgccatcgcgtgcccaattaccggtgactgggtggcaatgaccaaccatacctgggcg
ttctcaatagccgaaatgaaaaagaatctcggttttagtcatttggaaattattaacgac
tttaccgctgtatcgatggcgatcccgatgctgaaaaaagagcatctgatccagtttggc
ggtgcagaaccggtagaaggtaaacctattgcggtttacggtgccggaacagggcttggg
gttgcgcatttggtccatgtcgataagcgttgggtaagcttgccaggcgaaggcggtcac
gttgattttgcgccgaatagtgaagaagagggcattatcctcgaaatactgcgtgcagaa
attggtcatgtttcggcagagcgcgtgctttctggtcctgggctggtgaatttgtatcgc
gcgattgtgaaagccgacaatcgtctgccagaaaatctcaagccaaaagatattactgaa
cgcgcgctggctgacagctgcaccgattgtcgccgcgcgttgtcgctattttgtgtgatt
atgggtcgttttggcggcaaccttgcattgacgctgggaactttcggtggggtttatatt
gcaggtggcatcgtgccacgcttccttgagttcttcaaagcctccggtttccgtgccgca
tttgaagataaagggcgctttaaagaatatgtccatgatattccggtgtatctcatcgtc
catgacaatccgggccttctcggttccggcgcacatttacgccagaccttaggccacatt
ctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system