KEGG   Escherichia fergusonii: EFER_0823Help
Entry
EFER_0823         CDS       T00811                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
efe  Escherichia fergusonii
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EFER_0823 (fadJ)
   01212 Fatty acid metabolism
    EFER_0823 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EFER_0823 (fadJ)
   00650 Butanoate metabolism
    EFER_0823 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    EFER_0823 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    EFER_0823 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EFER_0823 (fadJ)
   00310 Lysine degradation
    EFER_0823 (fadJ)
   00380 Tryptophan metabolism
    EFER_0823 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EFER_0823 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EFER_0823 (fadJ)
   00281 Geraniol degradation
    EFER_0823 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    EFER_0823 (fadJ)
Enzymes [BR:efe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EFER_0823 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EFER_0823 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EFER_0823 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
839044..841188
Genome map
AA seq 714 aa AA seqDB search
MDMTSAFTLNVRLDHIAVVTIDVPGEKMNTLKAEFAAQVRAILKEIRENKEIRGVVFISA
KADNFIAGADINMIDHCNTAMEAETLARQGQQLMAEIHALPVPVIAAIHGACLGGGLELA
LACHGRICTDDPKTILGLPEVQLGLLPGSGGTQRLPRLVGLSTALDMILTGKQLRPGQAL
KSGLVDEIVPQSILLQAAVERAKQERQTPRSLPVRERILAGPLGRSLLFRFVSKKTDQKT
QGNYPATTRILDVIETGLSQGSSSGYDAEARAFGELAMTSQSQSLRNIFFASTEVKKDPG
STVQPGTLDSIGILGGGLMGGGIAFVTACKAGLPVRIKDINPQGINHALKYSWQLLDAKV
RRRHIKAGEQARQLAKISGTTDYQGFAHRDVVIEAVFEDLSLKQQMVAEVEKNCGLHTIF
ASNTSSIPISDIAAHATRPEQVIGLHFFSPVEKMPLVEVIPHAATSEKTIATIVKLAKKQ
GKTPIVVQDKAGFYVNRILAPYINEAIRLLTEGEKVETIDTALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVSSILNDDRKGRKNGRGFYLYGAKGRKSKKQVDPE
IYKIIAVQGQSKLSAQQITERCVMLMLNEAARCYREGVIRHARDGDIGAVFGIGFPPFLG
GPFRYMDSLGASEVVAVLQRLTSLYGSRFTPCEQLLQMAERGESFWKTSATDRH
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggacatgacatcagcatttactcttaatgtacgcctggaccacattgctgtggtaact
attgacgttcccggcgaaaagatgaacaccctcaaggctgagtttgccgctcaggtccgc
gccatcctgaaagaaatacgcgaaaacaaagagattcgcggtgttgtctttatctctgct
aaagcagataactttatcgctggtgcagatatcaacatgattgatcactgcaacaccgcc
atggaagccgaaaccctggcacgccaggggcaacagttaatggcagaaatccatgctctg
cctgtgccggtgattgccgccatacatggggcttgtttaggtggtggactggaactggct
ctggcctgccatggacgtatttgtactgatgatccaaaaaccattctgggattaccggag
gtacaacttggcctgttacccggctcaggaggaactcaacgcctgcctcgcctggtgggg
ttaagtactgctttggatatgattctgacgggcaagcagttgcgtcccggacaggcacta
aaatcagggctggtggatgaaattgttccccaatccattttattgcaggcggctgtggaa
cgcgcgaaacaggaaaggcaaacaccgcgttctttacctgtacgggagcgtattcttgcc
gggccgctcgggcgttcgcttctgtttcgctttgtcagtaaaaaaacagaccagaaaaca
cagggtaattatcctgctaccactcgcattctcgacgtcatcgaaacaggtctgtcacaa
ggtagcagtagcggatatgacgcagaagccagagcatttggtgagctggcgatgacatcg
caatcccagtcgctacggaatattttctttgccagtactgaagtaaaaaaagatccagga
agtacggtgcaacctggtactttagacagtattggtattctgggtggtggcctgatgggg
ggtggtatcgcctttgtaaccgcctgtaaagcgggtttacccgtacggattaaagacatt
aatccccagggcattaaccatgcgctgaaatacagttggcaactactggatgccaaagtg
cgtcgtcggcatataaaggctggtgagcaggccaggcaattagcgaaaatctccggtaca
accgattatcaaggctttgcacatcgggatgtcgttatcgaagcggtatttgaagattta
tcgttaaaacagcagatggtggctgaggttgagaaaaattgtggtttacacaccattttt
gcctcaaatacttcatctataccaataagcgatatcgcagctcatgcaacaaggcctgaa
caagttatcggtttacacttttttagcccggttgagaaaatgccactggtggaagttatt
cctcatgctgcaacatctgagaagacaattgccactattgtgaagctggcgaaaaaacag
ggaaaaacaccgattgttgttcaggataaggctggattctatgtaaatcgtattcttgct
ccttatatcaatgaggctattcgactattaaccgaaggtgaaaaggttgaaaccatagat
accgcgctggttaagttcggtttccctgtcgggccaatccaacttttggatgaggtcgga
attgatacaggtactaaaataatacctgtgcttgaggcggcatatggagaacgttttagc
gcccctgcaaatgttgtttcttcaattttgaatgatgatcgcaaaggcagaaaaaatggt
cgtggcttctatctttatggagcgaaagggcgtaaaagcaaaaaacaggttgaccctgaa
atttataagattattgccgtacaagggcagagtaagttatctgctcaacagataactgaa
cgttgcgtcatgctcatgcttaacgaagctgcgcgttgttacagagaaggcgttatccgt
catgctcgtgatggggatatcggtgcggtatttggcatcggttttcctccatttctcggg
gggccattccgttatatggactcgctgggggcttcagaagttgtcgctgtgctgcaacgg
ttaacgtcattgtatggttctcgcttcacaccatgtgagcagttgctccaaatggcggaa
cgtggtgaaagtttctggaaaacaagtgcaacggatcgtcattaa

DBGET integrated database retrieval system