KEGG   Escherichia fergusonii: EFER_1283Help
Entry
EFER_1283         CDS       T00811                                 

Gene name
ycfX
Definition
(GenBank) N-acetyl-D-glucosamine kinase
  KO
K00884  
N-acetylglucosamine kinase [EC:2.7.1.59]
Organism
efe  Escherichia fergusonii
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EFER_1283 (ycfX)
Enzymes [BR:efe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.59  N-acetylglucosamine kinase
     EFER_1283 (ycfX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1323005..1323916
Genome map
AA seq 303 aa AA seqDB search
MYYGFDIGGTKIALGVFDSGRQLQWEKRVPTPRDSYDAFLDAVCELVAEADQRFGCKGSV
GIGIPGMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
QYPLVMGLILGTGVGGGLIFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGCG
QIGCIENYLSGRGFAWLWQHYYHQPLQAPEIIALWEEGDERAQAHVDRYLDLLAVCLGNI
LTIVDPDLVVIGGGLSNFTAITTQLADRLPRHLLPVARVPRIERARHGDAGGMRGAAFLH
LSD
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtattacgggtttgatattggtggaacaaaaattgcgcttggcgtgtttgatagcggt
cggcagttgcagtgggaaaagcgggtgccgacaccgcgtgacagctatgacgcattttta
gatgcagtgtgcgagctggtggctgaagctgaccaacgttttggctgtaaaggttctgtc
ggcatcggtattccgggaatgccggaaacagaagatggtacgctgtatgccgccaatgtc
cctgctgccagcggtaaaccgctgcgtgccgacctgagcgcacgtcttgatcgcgatgta
cgccttgataacgatgccaactgttttgccctttctgaagcatgggatgatgaatttact
caatatccactggtgatggggttgattctcggcactggcgttggcggcgggctgattttc
aacggtaaaccgattaccggtaaaagctacattaccggcgagtttggccatatgcgtctg
ccggttgatgcattaaccatgatggggttggatttcccgttacgccgctgcggctgtggt
caaattggttgtatcgaaaattatctatcgggtcggggctttgcgtggctctggcaacac
tattatcatcaaccgttgcaggctcctgaaattattgccttatgggaagaaggcgatgag
cgggcgcaggcacacgttgatcgctatctggatttgctggcagtgtgtctgggaaatatc
ctgactattgttgatcctgatctggtggtgattggcgggggattatcaaactttacagca
ataacaacacaactggcggacaggttgccccggcatctgttacctgtagctcgtgtgccg
cgtattgaacgtgcgcgtcatggagatgcaggtggtatgcgcggcgcggcctttttacat
cttagtgattaa

DBGET integrated database retrieval system