KEGG   Escherichia fergusonii: EFER_1292Help
Entry
EFER_1292         CDS       T00811                                 

Gene name
yeaD
Definition
(GenBank) conserved hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
efe  Escherichia fergusonii
Pathway
efe00010  Glycolysis / Gluconeogenesis
efe01100  Metabolic pathways
efe01110  Biosynthesis of secondary metabolites
efe01120  Microbial metabolism in diverse environments
efe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFER_1292 (yeaD)
Enzymes [BR:efe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     EFER_1292 (yeaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CAQ88816
UniProt: B7LQ19
Position
complement(1331528..1332472)
Genome map
AA seq 314 aa AA seqDB search
MISKSDFGRSFFCLKIKDCVMIKKIFALPVIEQITAALSRRQLDELDVIVVDHPQVKASF
ALQGAHLLSWKPTGEEEVLWLSNNTPFKTGVAIRGGVPICWPWFGPAAQQGLPAHGFARN
LPWKLKSHEENANGVALTFELSHSEATKKYWPHDFRLLAHFKVGKTCEMELEAHGDFETT
SALHTYFNVGDIAEVKVSGLGDRYIDKVNDAKEGVLSDGIQTFPDRTDRVYLNPQTCSVI
ADAALKRKIDVEHRNHLNVVGWNPGPALSISMGDMPDDGYKTFVCVETAYATAPQKTTAE
KPSRLTQIVRVAKD
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgatctctaagagcgacttcggtcgctcttttttttgcctgaagataaaggactgcgtc
atgattaagaaaatttttgcccttccggttatcgaacaaatcacagcggccctttcccgc
cgccaactggatgaactcgatgtgattgttgtcgatcatccgcaggtaaaagcctctttt
gctttgcagggtgcccacctgctctcatggaaaccaactggcgaagaagaagttctgtgg
ctgagcaacaataccccctttaaaactggcgtcgctattcgtggtggtgtgccgatttgc
tggccgtggttcggtccggcagctcaacaaggtctgccagcacatggttttgcgcgtaac
ctgccctggaaactaaaatctcatgaggaaaatgccaacggcgtcgcgttaacctttgaa
ctcagccacagcgaagcgacaaaaaaatactggccgcatgactttaggctgttagcgcat
ttcaaagtgggtaaaacctgtgagatggagctggaagcacacggcgatttcgaaaccact
tctgccctgcatacctacttcaatgtcggcgatatcgcagaagtcaaagttagtggactg
ggtgatcgttacatcgataaagtcaatgatgccaaagaaggtgtactgagcgacggtata
cagactttcccggatcgaactgatcgtgtttacttaaatcctcagacctgtagtgtgatt
gctgacgcggcgttgaaacgtaaaattgacgttgaacatcgcaatcatctcaacgttgtc
ggctggaaccccggcccggcgctgtcgatcagcatgggcgatatgcctgacgacggttat
aaaacgtttgtttgcgttgaaacggcttatgctaccgcaccgcaaaaaacaactgcagag
aaaccgtctcgcctgacgcaaattgttcgcgtcgctaaagactaa

DBGET integrated database retrieval system