KEGG   Escherichia fergusonii: EFER_1296Help
Entry
EFER_1296         CDS       T00811                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19 3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
efe  Escherichia fergusonii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    EFER_1296 (pncA)
Enzymes [BR:efe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     EFER_1296 (pncA)
    3.5.1.-  
     EFER_1296 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1334620..1335297)
Genome map
AA seq 225 aa AA seqDB search
MASLRQMTKEILMTHRALLLVDLQNDFCAGGALAVPEGDNTVDIANQLINWCQSRDIPVI
ASQDWHPANHGSFASQHQVAVYSQGMLDGLPQTFWPDHCVQNSEGAALHPLLKQKAINRI
FHKGENPLVDSYSAFFDNGRRQKTTLDEWLREHNIGELIIMGLATDYCVKFTVLDALQLG
YRVNVITDGCRGVNINPQDSAQAFMEMSVAGATLYTLADWQETQE
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtggcgagcttacgccagatgactaaggagattttgatgacgcatcgcgctctgctactg
gtagatttgcaaaatgatttttgtgccggaggtgcgcttgctgtaccggaaggtgacaac
accgttgatattgctaaccagctgattaactggtgtcaatcacgggatataccggttatc
gccagccaggactggcatccggctaatcacggcagctttgccagtcagcatcaggttgca
gtctacagccagggaatgcttgacggtttaccacaaacgttctggcctgatcactgtgta
cagaatagcgaaggtgctgcattgcatcctttgctgaaacaaaaagctatcaatcgcatt
tttcacaaaggcgagaatccgttagttgatagctatagcgccttttttgataacgggcgg
cggcaaaaaaccacgctggatgagtggctacgtgaacataatattggcgaattgataatt
atgggtcttgccactgactactgcgttaaatttactgttctggatgccctgcaactgggt
taccgtgtcaacgtcatcactgatggttgccggggagtgaatattaacccacaagatagc
gctcaggcatttatggaaatgtctgttgctggtgccacgttatatacgctggcagactgg
caagagacgcaggagtaa

DBGET integrated database retrieval system