KEGG   Escherichia fergusonii: EFER_1495Help
Entry
EFER_1495         CDS       T00811                                 

Gene name
adhP
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
efe  Escherichia fergusonii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EFER_1495 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFER_1495 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    EFER_1495 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    EFER_1495 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EFER_1495 (adhP)
   00626 Naphthalene degradation
    EFER_1495 (adhP)
Enzymes [BR:efe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EFER_1495 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1530695..1531705)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAGYSVDGGMAEE
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLATEIGADLAINSRTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcagttgttacgaaggatcatcatgttgacgttacggataaaacgctgcgc
tcactgaaacatggcgaagccctgctgaaaatggagtgttgtggtgtatgtcataccgat
cttcatgttaagaatggcgattttggtgataaaaccggcgtgattctgggccatgaaggc
atcggtgtggtggcagaagttggccccggcgttacctcattaaaaccaggcgatcgcgcc
agcgtggcgtggttttacgaaggatgcggtcattgcgaatactgtaacagcggtaacgaa
acgctctgccgttcagtaaaaaatgccggatacagcgttgatggcggcatggcggaagag
tgcatcgtggtcgccgattacgcggttaaagtgccggatggcctggactcggcggcggcc
agcagcatcacctgcgcgggcgtcaccacctacaaagcagtaaaactatcaaaaattcgt
ccaggacagtggattgctatctacggtcttggcggtctgggcaacctcgccctgcaatac
gcgaaaaatgtctttaatgcaaaagtgatcgccattgatgtcaatgatgagcagttgaaa
ctggcaaccgaaataggtgctgatttagcgattaactcacgtaccgaagacgccgccaaa
attgtgcaggagaaaaccggtggcgctcacgcagcggtggtgacagcggtagctaaagct
gcgtttaactcggcagttgatgctgtccgtgctggcggtcgtgttgtggcagtcggtctg
ccgccggagtctatgagcctggacatcccacggctggtgctggatggtattgaagtggtc
ggttcgctagttggcacgcgccaggatctcaccgaagccttccagtttgccgccgaaggc
aaagtggtgccgaaagtcgccctgcgtccgttagcggacatcaacaccatctttactgag
atggaagaaggcaaaatccgtggccgtatggtgattgatttccgccgctaa

DBGET integrated database retrieval system