KEGG   Escherichia fergusonii: EFER_1550Help
Entry
EFER_1550         CDS       T00811                                 

Gene name
yneH
Definition
(GenBank) putative glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
efe  Escherichia fergusonii
Pathway
efe00220  Arginine biosynthesis
efe00250  Alanine, aspartate and glutamate metabolism
efe00471  D-Glutamine and D-glutamate metabolism
efe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EFER_1550 (yneH)
   00220 Arginine biosynthesis
    EFER_1550 (yneH)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    EFER_1550 (yneH)
Enzymes [BR:efe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     EFER_1550 (yneH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: CAQ89069
UniProt: B7LRC7
Position
1583014..1583940
Genome map
AA seq 308 aa AA seqDB search
MAVAMDNFVLESILRQVRPLIGKGKVADYIPALATVDGNRLGMAICTVDGQCYQAGDAEE
RFSIQSISKVLSLVVAMRHYSEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGA
LVVCDMLQGRLSAPRQRMLEVVRGLSGVADIAYDGVVARSEFEHSARNAAIAWLMKSFGN
FHHDVGTVLQNYFHYCALKMSCVELARTFVFLANQGKAIHIDEPIVTPMQARQINALMAT
SGMYQNAGEFAWRVGLPAKSGVGGGIVAIIPHEMAIAVWSPELDHAGNSLAGIAALEQLT
QRLGRSVY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggcagttgccatggataatttcgttttagagtctattttgcgtcaggtgcgtccactt
attggtaaggggaaagttgccgactacattccggcgttagctacagttgacggtaaccgt
ctgggaatggcgatttgtactgttgatgggcaatgttatcaggccggggatgctgaagag
cgtttctctattcagtcgatctccaaggtgctcagtctggtagtggcgatgcggcactac
agtgaggaggagatttggcagcgagtgggtaaagatccctccggttcgccgtttaactcg
ctggtacaactggagatggagcagggtatcccacgcaacccctttatcaatgccggggct
ctggttgtatgcgatatgctgcaaggtcgtcttagtgcgccgcgtcagcgaatgctggaa
gttgttcgcgggcttagcggtgtagcggatatcgcctatgacggggtggtggcgcgttct
gaatttgaacactcggcgcgtaatgcggctattgcctggctgatgaaatcctttggcaat
ttccatcatgatgtcggtactgttctgcaaaactattttcactactgcgcactgaaaatg
agttgtgtggagcttgctcgcacttttgtttttctggctaatcagggtaaggctattcat
attgatgaaccaatagtcacgccaatgcaggcgcggcaaattaatgctctgatggcgacc
agtggcatgtatcaaaatgccggagagtttgcctggcgcgtcggtttgcctgctaagtcg
ggtgttggcggcggaattgtggcgattattccccatgaaatggcaattgctgtctggagc
ccggagcttgatcacgcgggtaattcactggcaggtattgctgcgcttgaacagttaaca
caaaggctggggcgttcggtgtactga

DBGET integrated database retrieval system