KEGG   Escherichia fergusonii: EFER_1695Help
Entry
EFER_1695         CDS       T00811                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
efe  Escherichia fergusonii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EFER_1695 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EFER_1695 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EFER_1695 (trpB)
Enzymes [BR:efe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EFER_1695 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1744202..1745395
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFNDLLKNYAGRPTALT
KCQNITAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGM
FADFINETDVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEDGQIEESYSI
SAGLDFPSVGPQHAYLNSIGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALK
MMRENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattacttaacccgtattttggtgagtttggcggcatgtacgtgccacaaatc
ctgatgcctgctctgcgccagctggaagaagcttttgtcagcgcgcaaaaagatcctgaa
tttcaggcccagtttaacgacctgctgaaaaactatgctggtcgcccaaccgcgttgacc
aaatgccagaacattacagccggcactaacaccacgctgtatctgaagcgtgaagatttg
ctgcacggcggcgcgcataaaactaaccaggttctgggccaggctttgctggcgaagcgg
atgggtaaaaccgaaatcatcgccgaaaccggtgcaggtcagcatggcgtggcgtcggcc
cttgccagcgccctgctcggcctgaaatgccgtatttatatgggggccaaagacgttgaa
cgccagtcgcctaacgtttttcgtatgcgtttaatgggtgcggaagtgatcccggtgcat
agcggttctgcgacgctgaaagatgcctgtaacgaggcgctgcgcgactggtccggcagt
tatgaaaccgcgcactatatgctgggcaccgcagctggcccacatccttatccgaccatt
gtccgtgagtttcagcggatgattggcgaagaaaccaaagcacagattctggaaagagaa
ggtcgtctgccggatgccgtcatcgcttgtgttggcggcggttcgaatgccatcggcatg
tttgcagatttcatcaacgaaaccgacgtcggcctgattggtgtagagccaggcggtcat
ggtatcgaaactggcgagcacggcgcaccgttaaaacatggtcgcgtgggcatctatttc
ggtatgaaagcgccaatgatgcaaaccgaagacgggcaaattgaagagtcttactcgatt
tctgccggactggatttcccgtcagtcggcccacaacacgcttatctcaacagcattgga
cgcgctgattacgtgtcaatcaccgatgatgaagcactggaagcctttaaaacgctgtgc
ctgcacgaagggattattccggcgctggaatcctcccacgcgctggcccacgcactgaaa
atgatgcgcgaaaacccggaaaaagagcagctgctggtcgttaatctttccggtcgcggc
gataaagacatcttcaccgttcacgatattttgaaagctcgaggggaaatctga

DBGET integrated database retrieval system