KEGG   Escherichia fergusonii: EFER_1696Help
Entry
EFER_1696         CDS       T00811                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
efe  Escherichia fergusonii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EFER_1696 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EFER_1696 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EFER_1696 (trpA)
Enzymes [BR:efe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EFER_1696 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1745395..1746201
Genome map
AA seq 268 aa AA seqDB search
MERYETLFARLKERKEGAFVPFVTLGDPGIEQSLKIIDALIEAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVTPAQCFEMLGLIRQKHPNIPIGLLMYANLVFNKGIDEFYAQCEK
VGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADEDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKI
IEQHINEPEKMLAVLKAFVQPMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctatgaaactctgtttgcccggttgaaggagcgcaaagaaggcgcatttgtt
cctttcgtcaccctcggtgatccgggcattgagcagtcgttgaaaattatcgatgcttta
atcgaagctggtgctgacgcgctggagttaggcatccccttctccgacccactggcggat
ggcccgacgattcaaaacgccacactgcgtgcctttgcggcaggtgtgaccccggcacaa
tgttttgaaatgctgggactgattcgccagaaacacccgaacattcccattggcctgctg
atgtatgccaatctggtgtttaacaaaggcattgatgagttttacgcccagtgcgagaag
gtcggcgtcgattcggtgctggttgccgatgtgcccgtggaagagtctgcgcccttccgc
caggccgcgttgcgccataatgtcgcacctatctttatttgcccgccgaatgccgacgag
gatttgctgcgccagattgcctcttatggccgtggttacacctatttattgtcgcgtgcg
ggcgtgaccggagctgaaaaccgcgccgcgttacctctcaatcatctggttgcgaagctg
aaagagtacaacgctgcgcctccattgcaaggatttggtatttccgccccggatcaggta
aaagcagcgattgatgcaggagctgcgggcgcgatttctggttcggcaattgttaaaatc
atcgagcaacatattaatgagccagagaaaatgctggcggtactgaaagcttttgtacaa
ccgatgaaagcagcgacgcgcagttag

DBGET integrated database retrieval system