KEGG   Escherichia fergusonii: EFER_1705Help
Entry
EFER_1705         CDS       T00811                                 

Gene name
cls
Definition
(GenBank) cardiolipin synthase 1
  KO
K06131  
cardiolipin synthase A/B [EC:2.7.8.-]
Organism
efe  Escherichia fergusonii
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    EFER_1705 (cls)
Enzymes [BR:efe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     EFER_1705 (cls)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1751082..1752542
Genome map
AA seq 486 aa AA seqDB search
MTTFYTVVSWLVILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSFGE
LHLGKRRAERARAMWPSTAKWLNDLKSCKHIFAEENSSVASSLFKLCERRQGIAGVKGNQ
LQLLTDSDDVMQALIRDIQLARHNIEMVFYIWQPGGMADKVAESLMAAARRGIHCRLMLD
SAGSVAFFRSPWAAMMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMIMIDNYIAYTGSM
NMVDPRFFKQDAGVGQWVDVMARMEGPIATAMGVIYSCDWEIETGKRILPPPPDVNIMPF
EQASGHTIHTIASGPGFPEDLIHQALLTATYSAREYLIMTTPYFVPSDDLLHAICTAAQR
GVDVSIILPRKNDSMLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV
NLDMRSLWLNFEITLAIDDKGFGADLAAVQDDYISRSRLLDERLWLKRPLWQRVAERLFY
FFSPLL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccttctacacggtggtgagttggctggtcattctgggatactggttactcatc
gctggcgtaacattacgtattctaatgaaacgtcgtgcagttccctccgcaatggcctgg
ttgctgattatctacatcctgccgctggtgggcattattgcttatctctcttttggtgaa
cttcatttaggtaaacgccgtgctgaacgagccagggcgatgtggccttcaaccgcaaaa
tggcttaacgacctgaaatcctgcaagcacatatttgcagaagagaacagtagtgttgct
tcttctttatttaagttgtgtgaacgtcgccaggggatcgcaggagtaaaaggtaaccaa
ttacaactgctcaccgattctgatgatgtgatgcaagctctaatccgcgatattcagctt
gcccgccataatattgagatggtgttttatatctggcagcctggtggcatggccgataaa
gtcgctgagtcattaatggctgcagctcgtcgtggtattcattgtcgactgatgcttgat
tctgctggcagtgtggcttttttccgtagcccatgggcagccatgatgcgaaatgcaggt
attgaagtagtcgaggcgctgaaagttaacctgatgcgtgtctttttgcgacgcatggac
cttcgccagcaccgcaaaatgatcatgatcgacaattatatcgcttacactggcagcatg
aatatggtcgatccgcgcttctttaaacaagatgccggtgtaggccagtgggtagatgtc
atggcgcgcatggaaggccccatcgcgacagctatgggcgtgatttattcctgcgactgg
gaaattgaaaccggtaaacgcattctgccaccgccgcctgacgtcaatatcatgccattt
gagcaagccagcggtcataccattcacaccattgcttctggccctggcttcccggaggat
ttgattcaccaggccttgctgactgcaacatattcagctcgtgaatatttaattatgacg
acaccctacttcgtgcccagtgatgacttgctacatgcaatttgtactgctgcacagcgt
ggcgtggacgtcagcattatcctgccacgtaaaaatgactctatgctggttggttgggcc
agtcgtgctttcttcaccgaattgctggcagccggagttaaaatttaccagtttgaaggt
ggtttattacataccaagagcgtactggttgatggtgagcttagtcttgtcggtacagtt
aatctggatatgcgcagtttgtggcttaattttgaaatcacactcgccattgacgacaaa
ggattcggcgctgatctcgccgcagtacaggatgactatatctcccgttcccggcttctt
gatgaacggttgtggttaaaacgaccactctggcagcgagtcgcagagcgattgttttac
ttcttcagcccgttgctgtaa

DBGET integrated database retrieval system