KEGG   Escherichia fergusonii: EFER_1719Help
Entry
EFER_1719         CDS       T00811                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
efe  Escherichia fergusonii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EFER_1719 (galU)
   00052 Galactose metabolism
    EFER_1719 (galU)
   00500 Starch and sucrose metabolism
    EFER_1719 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    EFER_1719 (galU)
Enzymes [BR:efe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EFER_1719 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1767697..1768605)
Genome map
AA seq 302 aa AA seqDB search
MAAINSKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLDEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGDEPVAVILPDVILDEYESDLSQDNLAEMIRRFDETGNSQIMVEPVDDVTAYGV
VDCKGVDLAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGAEFKSWLEEEVGI
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgccattaattcgaaagtcaaaaaagccgttatcccggtagcgggattaggaacc
aggatgttaccggcaacgaaggctatcccaaaagagatgcttccgctggtagataagcca
ttaattcagtacgtcgtgaatgaatgtattgcagcgggtatcacggaaattgtcctggta
acccactcttcaaaaaattccatcgaaaaccactttgataccagttttgaactggaagcg
atgctggaaaaacgtgttaaacgccagctgcttgatgaagtgcaatctatttgcccgccg
catgtcactattatgcaggtacgtcaggggctggcaaaaggccttggccacgcagtgctt
tgtgcccatccggtggtaggcgatgaaccggtcgcagttattctgcctgacgttattctt
gacgaatatgagtccgatttatcccaggataacctggcagaaatgattcgtcgttttgat
gaaacaggaaatagccaaatcatggttgagcctgtagacgacgttactgcatatggtgta
gtcgattgcaaaggtgttgatttagctccgggtgaaagcgtaccaatggtcggtgtggta
gaaaaaccaaaagccgacgttgcaccttctaatcttgctattgtagggcgttacgttctg
agcgcagatatctggcctctgctggctaaaactcctccgggagcaggggatgaaattcag
cttaccgatgcaattgatatgctgatcgaaaaagaaactgttgaagcctaccatatgaaa
ggcaagagccacgactgtggtaataaattaggctatatgcaggcatttgtggaatacggt
atccgtcataatactcttggcgcagaatttaaatcctggctggaagaagaagttggtatt
aagaagtaa

DBGET integrated database retrieval system