KEGG   Escherichia fergusonii: EFER_2103Help
Entry
EFER_2103         CDS       T00811                                 

Gene name
hisD
Definition
(GenBank) bifunctional histidinal dehydrogenase and histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
efe  Escherichia fergusonii
Pathway
efe00340  Histidine metabolism
efe01100  Metabolic pathways
efe01110  Biosynthesis of secondary metabolites
efe01230  Biosynthesis of amino acids
Module
efe_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    EFER_2103 (hisD)
Enzymes [BR:efe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     EFER_2103 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh FdhE
Motif
Other DBs
NCBI-ProteinID: CAQ89606
UniProt: B7LUF1
Position
2128919..2130223
Genome map
AA seq 434 aa AA seqDB search
MSFNTIIDWNSCTAEQQRQLLMRPAISASESITRTVNDILDNVKTRGDEALREYSAKFDK
TTVTALKVSADEIAAASERLSDELKQAMAVAVKNIETFHTAQKLPPVDVETQPGVRCQQV
TRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCKKVVLCSPPPIADEILYAAQLCGVQD
VFNVGGAQAIAALAFGTESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADMARRVAEAVERQLAELPRAETARQ
ALSASRLIVTNDLAQCVEISNQYGPEHLIIQTRNARELVDGITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKEGFSTLASTIETLAAAERLTAHK
NAVTLRVNALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaacacaatcattgactggaatagctgtactgcggagcaacaacgccagctg
ttaatgcgcccggcgatctccgcttctgaaagcattacccgcactgttaacgatattctc
gataacgtgaaaacgcgtggcgatgaggccttgcgggaatacagcgcgaagtttgataaa
accacggttaccgcgctgaaggtatctgcggatgagatcgccgccgccagcgaacgcctg
agcgacgagctaaaacaggcgatggcggtggcagtaaagaatattgaaaccttccacact
gcgcaaaaactgccgccggtagatgtcgaaacgcagccaggcgtgcgttgccagcaagtt
acgcgcccggtagcttcagtgggtttgtatattcctggcggctccgccccgctcttttca
acggtattaatgctggcgactccggcgcgtatagcaggctgtaaaaaagtagtgttgtgc
tcaccgccgccgattgccgatgaaattctttacgcggcgcagctgtgcggcgtgcaggac
gtgtttaacgtcggtggcgcacaagccattgccgcactggcgtttggtacagaatccgtg
ccaaaagtggacaaaatcttcgggcctggcaacgcctttgtcaccgaggcaaaacgtcag
gtgagccagcgtctggacggtgcggcgatcgatatgcccgcaggcccatcggaagtgttg
gtgattgccgacagcggcgcaacgccggatttcgtggcttctgatttgctctctcaggct
gaacacggcccggattcacaggtgattttgctgactcctgatgctgatatggcgcgtcgc
gttgccgaagccgtcgaacgccagctggcagaactgccgcgagccgaaaccgcccgtcag
gcactgagcgccagccgcctgatcgtaaccaacgatttagcgcagtgcgtggagatctcc
aaccagtacggcccggagcacctgatcattcagacccgcaacgcccgcgaactggtcgat
ggcattaccagcgccggttcggtatttctcggtgactggtcaccggaatcggcaggtgat
tacgcctccggcaccaaccacgtgctgccgacttacggttataccgccacctgttccagc
ctcgggctggcagatttccagaaacgcatgaccgtacaggaactgtcgaaagaaggcttt
tccacgctggcttcgaccattgaaacactggccgccgccgagcgcctgactgcccacaaa
aatgccgttactttgcgtgttaacgcccttaaggagcaagcatga

DBGET integrated database retrieval system