KEGG   Escherichia fergusonii: EFER_2354Help
Entry
EFER_2354         CDS       T00811                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
efe  Escherichia fergusonii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EFER_2354 (gpmA)
   01230 Biosynthesis of amino acids
    EFER_2354 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFER_2354 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    EFER_2354 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EFER_2354 (gpmA)
Enzymes [BR:efe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EFER_2354 (gpmA)
Exosome [BR:efe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EFER_2354 (gpmA)
  Exosomal proteins of melanoma cells
   EFER_2354 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2410727..2411479
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gctggtaagctgctgaaagaggaaggttacagctttgactttgcttacacctctgtgctg
aaacgcgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcggaaaccgctgaaaaatatggtgacgagcaggtgaaacagtggcgtcgtggttttgcg
gtaactccgccggaactgactaaagatgatgagcgttatccgggccacgatccacgttac
gcaaagctgagcgagaaagagctgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaactattctgccgcgaatgaagagcggtgagcgcgtaatc
atcgccgcacacggtaactcgttacgtgcgctggtgaaatatctcgataatatgagcgaa
gaagagattcttgagctgaatatcccgactggcgtgccactggtttatgaattcgacgag
aatttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcggcgaaagca
gcggccgttgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system