KEGG   Escherichia fergusonii: EFER_2517Help
Entry
EFER_2517         CDS       T00811                                 

Definition
glycerol kinase 2 (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
efe  Escherichia fergusonii
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:efe00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2583242..2584762
Genome map
AA seq 506 aa AA seqDB search
MFAGNKEFVIALDEGTTNAKAIALDGFGNVVAKFSQPLAIQTPREGWVEQSGEALISASL
DVIAQAISHVGAENVAALAISNQRETAIGWYRQSGKPLNAAITWQCTRSAEFCETLRREG
KEQQIKTTTGLPIAPLFSAFKMRWLLESTSEGVQLADQGEICLGTIDAWLLWNLTAGDSF
CCDHSNAARTQLLNLKTGEWDEEMLALFHIPRAALPEIKPSSGLFGYTRGLKTIPDGIPV
MAMVGDSHAALFGHALGEAGCVKATYGTGSSVMAPVNSAQCDIATLATTIAWHDGENIVY
GLEGNIPHTGDAVAWMADSTGLSELTDAELAHELNTLPASVDSTMGVYFVPALTGLGAPW
WDDSARGVVCGLSRGVKRAHLIRAALESITYQIADVVEAMQQHDNFHLSALMVDGGPTKN
DWLMQYQADLLGCPVMRSDVPELSAIGAGLLARKALTPGTVADLKTLLTEHSEFKPDMAR
HQRLQKRWQEWRHAVNRTLWKPASSI
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcaggaaataaagagttcgttattgcgttggatgagggtaccaccaatgcaaaa
gccatcgcacttgatggtttcggtaacgtggtggcgaagttttctcaaccacttgctatt
cagacgccacgtgaaggctgggttgagcaatccggggaagcgttaatctctgcctcgctt
gacgttattgcccaggccatcagccacgtgggggcagaaaatgtagcggctctggctatc
agtaatcagcgtgaaacggctatcggctggtatcgtcagagtggaaaaccactcaatgcg
gcgattacctggcaatgcacgcgcagtgcagagttttgtgaaacacttcgtcgcgagggc
aaagagcagcaaattaaaacgactacaggcctgcctatcgccccgctattttccgctttc
aagatgcgttggctactggaatctacatctgagggtgtgcaacttgccgaccagggtgaa
atttgtctcggcaccattgatgcctggttactatggaacttgactgctggcgattcattt
tgctgcgaccactctaacgccgcgcgaactcaattacttaacctgaaaacaggcgagtgg
gatgaggaaatgctggcattgtttcatattccacgcgctgcattgccagaaattaaacca
tccagtggcctgttcggttatacccgagggcttaaaacaattccggatggtattcccgtc
atggcgatggtgggcgattctcacgccgctctttttggtcatgcgttgggagaagcggga
tgtgtgaaagcgacctatgggaccggttcttccgtcatggcccccgtcaactctgctcag
tgtgatatcgccacacttgccacaaccattgcctggcatgacggcgaaaatattgtttac
ggtctggaaggaaatatcccccacaccggggatgccgtggcatggatggctgatagcacc
ggtttaagtgaactgacagacgctgagctggcccacgaactgaataccctgccagcctca
gtggattcgactatgggcgtttattttgttcctgctctcactggcctgggcgcaccatgg
tgggatgacagtgctcgcggcgtggtgtgtggcttaagccgtggcgtaaagcgcgcgcat
ttgattcgcgccgcactggaatcaatcacttaccaaattgcagatgtagtagaagccatg
caacagcatgataattttcacttatcggcgttaatggtggatggcggcccgaccaaaaat
gactggttgatgcaatatcaggcggatctgctgggttgcccggtgatgcgcagtgatgtg
ccagagctttcggccattggtgcgggtctgctcgcccgcaaagcgcttacccccggcacc
gttgcagatttaaaaacgttattaactgaacacagtgaatttaaaccggacatggcgcgt
catcagcgactgcaaaagagatggcaggagtggcgtcatgcggtaaacagaacattatgg
aaaccggcatcgtcaatttga

DBGET integrated database retrieval system