KEGG   Escherichia fergusonii: EFER_2517Help
Entry
EFER_2517         CDS       T00811                                 

Definition
glycerol kinase 2 (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
efe  Escherichia fergusonii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    EFER_2517
Enzymes [BR:efe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     EFER_2517
Exosome [BR:efe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EFER_2517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2583242..2584762
Genome map
AA seq 506 aa AA seqDB search
MFAGNKEFVIALDEGTTNAKAIALDGFGNVVAKFSQPLAIQTPREGWVEQSGEALISASL
DVIAQAISHVGAENVAALAISNQRETAIGWYRQSGKPLNAAITWQCTRSAEFCETLRREG
KEQQIKTTTGLPIAPLFSAFKMRWLLESTSEGVQLADQGEICLGTIDAWLLWNLTAGDSF
CCDHSNAARTQLLNLKTGEWDEEMLALFHIPRAALPEIKPSSGLFGYTRGLKTIPDGIPV
MAMVGDSHAALFGHALGEAGCVKATYGTGSSVMAPVNSAQCDIATLATTIAWHDGENIVY
GLEGNIPHTGDAVAWMADSTGLSELTDAELAHELNTLPASVDSTMGVYFVPALTGLGAPW
WDDSARGVVCGLSRGVKRAHLIRAALESITYQIADVVEAMQQHDNFHLSALMVDGGPTKN
DWLMQYQADLLGCPVMRSDVPELSAIGAGLLARKALTPGTVADLKTLLTEHSEFKPDMAR
HQRLQKRWQEWRHAVNRTLWKPASSI
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcaggaaataaagagttcgttattgcgttggatgagggtaccaccaatgcaaaa
gccatcgcacttgatggtttcggtaacgtggtggcgaagttttctcaaccacttgctatt
cagacgccacgtgaaggctgggttgagcaatccggggaagcgttaatctctgcctcgctt
gacgttattgcccaggccatcagccacgtgggggcagaaaatgtagcggctctggctatc
agtaatcagcgtgaaacggctatcggctggtatcgtcagagtggaaaaccactcaatgcg
gcgattacctggcaatgcacgcgcagtgcagagttttgtgaaacacttcgtcgcgagggc
aaagagcagcaaattaaaacgactacaggcctgcctatcgccccgctattttccgctttc
aagatgcgttggctactggaatctacatctgagggtgtgcaacttgccgaccagggtgaa
atttgtctcggcaccattgatgcctggttactatggaacttgactgctggcgattcattt
tgctgcgaccactctaacgccgcgcgaactcaattacttaacctgaaaacaggcgagtgg
gatgaggaaatgctggcattgtttcatattccacgcgctgcattgccagaaattaaacca
tccagtggcctgttcggttatacccgagggcttaaaacaattccggatggtattcccgtc
atggcgatggtgggcgattctcacgccgctctttttggtcatgcgttgggagaagcggga
tgtgtgaaagcgacctatgggaccggttcttccgtcatggcccccgtcaactctgctcag
tgtgatatcgccacacttgccacaaccattgcctggcatgacggcgaaaatattgtttac
ggtctggaaggaaatatcccccacaccggggatgccgtggcatggatggctgatagcacc
ggtttaagtgaactgacagacgctgagctggcccacgaactgaataccctgccagcctca
gtggattcgactatgggcgtttattttgttcctgctctcactggcctgggcgcaccatgg
tgggatgacagtgctcgcggcgtggtgtgtggcttaagccgtggcgtaaagcgcgcgcat
ttgattcgcgccgcactggaatcaatcacttaccaaattgcagatgtagtagaagccatg
caacagcatgataattttcacttatcggcgttaatggtggatggcggcccgaccaaaaat
gactggttgatgcaatatcaggcggatctgctgggttgcccggtgatgcgcagtgatgtg
ccagagctttcggccattggtgcgggtctgctcgcccgcaaagcgcttacccccggcacc
gttgcagatttaaaaacgttattaactgaacacagtgaatttaaaccggacatggcgcgt
catcagcgactgcaaaagagatggcaggagtggcgtcatgcggtaaacagaacattatgg
aaaccggcatcgtcaatttga

DBGET integrated database retrieval system