KEGG   Escherichia fergusonii: EFER_2650Help
Entry
EFER_2650         CDS       T00811                                 

Gene name
hemB
Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
efe  Escherichia fergusonii
Pathway
efe00860  Porphyrin and chlorophyll metabolism
efe01100  Metabolic pathways
efe01110  Biosynthesis of secondary metabolites
efe01120  Microbial metabolism in diverse environments
Module
efe_M00121  Heme biosynthesis, glutamate => heme
efe_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EFER_2650 (hemB)
Enzymes [BR:efe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     EFER_2650 (hemB)
Exosome [BR:efe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EFER_2650 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: CAQ90145
UniProt: B7LML2
Position
2722423..2723397
Genome map
AA seq 324 aa AA seqDB search
MTELIHRPRRLRKSAALRAMFEETTLSLNDLVLPIFVEEEIDDYKAIDAMPGVMRIPEKY
LAREIERIANAGIRSVMTFGISHHTDETGSDAWKEEGLVARMSRICKQTVPEMVVMSDTC
FCEYTSHGHCGVLCEHGVDNDATLINLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMNPMNRREAIRESLLDEAQG
ADCLMVKPAGAYLDVLRDIRERTELPVGAYQVSGEYAMIKFAAQAGAIDEEKVVLESLGS
IKRAGADLIFSYFALDLAEKKILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagaattaatccatcgccctcgccgtctgcgcaaatcagctgcgctccgcgctatg
tttgaagagacaacactcagcttaaatgatctggtgttgccgatctttgttgaagaagaa
atcgacgattacaaagccatcgacgccatgcctggcgtgatgcgcatcccggagaagtat
ctggcccgtgaaattgaacgtattgctaacgcgggtatccgctccgtaatgacgtttggt
atttcccaccataccgatgaaaccggtagcgatgcgtggaaagaagaaggtctggtggcg
cgtatgtcgcgcatttgtaagcagaccgtgccagaaatggtggttatgtccgacacctgt
ttttgcgaatatacctcacacggtcactgcggtgttctgtgcgaacatggtgttgataac
gacgcgacattgatcaacctgggtaaacaggctgtcgttgccgccgctgctggcgcagat
tttatcgccccttcagcggcaatggatgggcaagttcaggcgattcgccaggcactggat
gccgccggatttaccgatacggcaatcatgtcctactccactaaatttgcctcttctttc
tatggtccattccgagaagccgccggaacagccttaaaaggtgatcgcaaaacctatcag
atgaatccaatgaaccgtcgcgaagcaattcgcgaatcgttactggatgaagcgcaaggc
gcagactgcctgatggttaaacctgcgggagcctatcttgatgtgttacgtgatattcgt
gagcgtaccgaactgccggttggcgcttatcaggtcagtggcgaatacgcgatgatcaag
tttgccgcgcaagcaggcgcaatagatgaagagaaagtggtgctggaaagtttaggatcg
atcaagcgcgcgggtgcggatctgatctttagctatttcgcactcgatctggcagagaaa
aaaatcctccgttga

DBGET integrated database retrieval system