KEGG   Escherichia fergusonii: EFER_2656Help
Entry
EFER_2656         CDS       T00811                                 

Gene name
lacZ
Definition
beta-D-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
efe  Escherichia fergusonii
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    EFER_2656 (lacZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    EFER_2656 (lacZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    EFER_2656 (lacZ)
Enzymes [BR:efe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     EFER_2656 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2728442..2731675
Genome map
AA seq 1077 aa AA seqDB search
MKKRPGINTKVVTPLLFSYLLQTIRPRAHICTLNKTLIYSLWQDSQQTTLSQDTAMPLNT
DSLAAVLHRRDWENPAISQLNRLAAHPSFSSWRSAEDARNNLTSGSVLNLNGEWRFTWYP
FPEAVPESWLLYDTDNADTVTVPSCWQMDGYDAPIYTNITYPIPVNPPFVPVENPTGCYS
VIFTVDDAWRQSGQTRIIFDGVNSAFHLWCNGCWVGYSQDSRLPSEFDLSDFLQEGENRL
AVMVLRWCDGSYLEDQDMWRMSGIFRDVTLLHKPTSQINDMHVNTHFNDDFSRAALEAEV
RINSDDVREQLVTVQLWQGETLIDEETAPPGSEIIDERGAYNDRVTLRLSVERPALWSAE
TPNLYRVVFLLQTADGTLIEAEACDVGFRQVKIENGLLLLNGKPLLIRGVNRHEHHPLHG
QVMDRETMLQDILLMKQNNFNAVRCSHYPNHPLWYTLCDQYGLYVVDEANIETHGMVPMN
RLSDDPQWLPAMSQRVTRMVQRDRNHPCIIIWSLGNESGHGANHDALYRWVKSTDPSRPV
QYEGGGANTAATDIICPMYARVDEDQPFPAVPKWSIKKWLSLPGEQRPLILCEYAHAMGN
SLGGFSKYWQAFRQYPRLQGGFVWDWVDQSLIKYDEEGHPWSAYGGDFGDTPNDRQFCMN
GLVFADRTPHPALTEAKHAQQFFQFRLLERKIEVTSEYMFRHSDNEILQWSLAWDGNTVA
SGEESLDVAACSTQVITLPEYPLSQMPGQLWLTVQVIQPNATAWSEAGHISAWQQWLIAE
NLSTESPTAASCTPDLSIDDAFFSVESGHKRWQFNRHSGFLSQYWLDDQPQLLSPLMDQF
TRAPLDNDIGVSEAHHIDPNAWVERWKAAGHYQPEVLLLQCEAQALSQSVLITTAHAWQY
QGKTLFISRKTYRIDGHGEMFIAVNVEVASDTPHPARVGLTCQLAQVAERVNWLGLGPEE
NYPDRLSAACYDRWERPLSAMYTPYVFPSENGLRCGTRELNYGSHQWRGDFQFNISRYSQ
KQLMETSHRHLLQAEEGTWLNIDGFHMGVGGDDSWSPSVSPEFLLNAGRYYYQVSWR
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaacgccccggcattaatacgaaagttgtaacgcccctcctcttctcatacttg
ttacagacaattcgtcctcgcgcacacatttgcacactgaataagacgcttatttatagc
ctatggcaagatagccagcagacgactttatctcaggataccgccatgcccttgaatacg
gattcacttgcagctgtcttacatcgtcgcgactgggaaaacccggcgataagtcaactc
aaccgcctggcagcacatccctctttcagcagctggcgcagtgctgaagacgctcgcaat
aacctgacttccggtagtgtgcttaacctgaacggtgaatggcgatttacatggtatccg
ttccctgaagccgtaccggaaagttggttgttgtacgacaccgacaatgccgacacggtg
accgtaccttcatgctggcagatggatggctacgacgcgccaatttacaccaacatcacc
tacccaattccggttaatcccccttttgttcctgtggaaaatcccacgggttgttattca
gttatctttacggtggatgacgcctggcggcagtcagggcagacacgaataatttttgat
ggtgtcaattccgcatttcatttgtggtgtaacggctgttgggtaggttattcccaggat
agccgactcccttctgagtttgatctcagtgacttcttgcaggaaggcgaaaaccgcctg
gcggtaatggtgctgcgctggtgtgacggtagctacctggaagatcaggatatgtggcgg
atgagtggtatttttcgtgacgttacactgctgcataaacctaccagtcaaatcaacgat
atgcatgtgaatacgcactttaacgatgattttagccgggcagctctggaggcagaggtc
agaatcaacagcgacgacgtcagagagcagcttgtcacagtgcaattgtggcagggagaa
acgctgattgatgaagaaaccgcgccacctggcagtgaaattattgatgagcgcggcgca
tataacgatcgagtaacgttacgtctttcagtggaaagacctgcactctggagtgcggaa
acgcccaacctttaccgcgtcgtattcttgttacaaaccgctgacggcactttgatagaa
gccgaagcgtgtgatgtcggttttcgtcaggtcaaaattgaaaacgggttattgctgctt
aacggaaaaccgttgctgattcgtggagtgaaccgccatgagcatcatccgctgcatggg
caggtgatggaccgtgaaaccatgctgcaagatatcctgctgatgaagcagaataacttc
aatgctgtccgctgttcgcattaccctaatcatcctttgtggtacacactttgcgaccag
tacgggctatatgtggttgatgaggcaaatatcgaaacccacggcatggtgccgatgaac
cgtctgagtgatgatccacagtggttacccgccatgagccagcgcgtaacacggatggtg
cagcgagaccgcaatcatccctgcattataatctggtcattgggtaatgagtctggtcat
ggtgcaaatcacgatgcgctttatcgctgggtaaaatcaaccgatccttcccgcccggtg
cagtatgaaggtggaggagcaaacacggcggcaaccgatatcatttgcccgatgtacgcc
cgtgtcgatgaagatcagcccttcccggcagtgccaaaatggtcgattaaaaaatggctt
tcactacctggtgaacaacgcccgttaatactctgcgaatacgcccacgcgatggggaac
agcctcggcggctttagcaaatactggcaggcatttcgtcagtatccgcgtttacaaggt
ggttttgtctgggactgggtggatcagtcgctgattaaatatgatgaagagggtcatccg
tggtcggcttacggcggtgattttggtgatacgcctaatgaccgtcagttctgtatgaac
ggtctggtctttgccgatcgcacgccgcatccggcactaacggaggcgaaacatgctcaa
caatttttccagttcaggctgctcgaacggaaaattgaagtcaccagtgaatacatgttc
cgccacagcgataatgagatcctgcaatggtcgctagcgtgggatggaaacactgtggcg
agtggcgaagagtctctggatgtcgcagcatgtagcactcaagttatcaccttgcctgaa
taccctctttcgcaaatgcctgggcaactatggctaaccgtacaagtgatacaacctaac
gcaacagcctggtctgaagcgggtcatatcagcgcctggcagcagtggctgattgctgaa
aatctttctactgaatccccaacggcggcttcctgtacacctgatttatcaattgatgat
gctttttttagcgtggagtcaggtcataaacgttggcaatttaaccgccattcaggtttt
ctcagccaatactggcttgatgaccagccgcagttattgtctccgcttatggatcaattt
acccgtgcgccgctggacaacgatattggtgtcagcgaagcccaccatattgatcctaac
gcctgggtggaacgctggaaagccgccgggcattaccagccagaggtgttattactgcaa
tgtgaagcacaggcgctttcacagtcggtactgataaccactgcacatgcctggcagtat
cagggtaagacgctgtttatcagccgaaaaacctatcgtattgatgggcatggtgagatg
ttcattgctgttaatgttgaggttgcaagcgatacaccgcatccggcacgtgttggcctc
acctgccaactggcgcaagtggcagagcgcgtaaactggctgggattaggcccggaagaa
aactacccagacagactaagtgcagcctgttatgaccgctgggagcgaccattgtcagcg
atgtatacaccctacgtcttccccagtgaaaacggtctgcgttgtggcactcgcgaattg
aattatggctcacaccaatggcgaggcgactttcagttcaatatcagccgttatagccaa
aagcaactcatggagaccagccatcgccatctgctacaagcggaagaaggcacatggcta
aatatcgatggttttcatatgggagttggcggtgatgactcatggagcccgtcagtttcg
ccggagtttttattgaacgctggtcgttattattatcaggtgagctggcgataa

DBGET integrated database retrieval system