KEGG   Escherichia fergusonii: EFER_2701Help
Entry
EFER_2701         CDS       T00811                                 

Gene name
ybcS
Definition
lysozyme; DLP12 prophage
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
efe  Escherichia fergusonii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2775696..2776193)
Genome map
AA seq 165 aa AA seqDB search
MPPSLRKAVAAAIGGGAIAIASVLITGPSGNDGLEGVRHNPYKDIVGVWTVCYGHTGKDI
MLGKTYTEAECKALLNKDLATVARQINPYIKVDIPETTRGALYSFVYNVGAGNFRTSTLL
RKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREICLWGQQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatcattacgaaaagctgttgctgctgctattggtggcggggctattgctata
gcatctgtgttaatcactggcccaagtggtaacgatggtctggaaggtgtgagacataat
ccttacaaagacatagttggtgtatggactgtatgttacggacacaccggaaaagacatt
atgctcggtaaaacgtataccgaagcagaatgcaaagccctcctgaataaagaccttgcc
actgtcgccagacaaattaacccgtacatcaaagtcgatataccggaaacaacgcgcggc
gctctttactcgttcgtctacaacgtgggtgctggcaatttcagaacatcgacgcttctt
cgcaaaataaaccagggtgatatcaaaggcgcatgtgatcagctacggcgctggacatac
gctggcggtaagcaatggaaaggtctcatgactcgtcgtgagattgagcgtgaaatctgt
ttgtggggtcagcaatga

DBGET integrated database retrieval system