KEGG   Escherichia fergusonii: EFER_2837Help
Entry
EFER_2837         CDS       T00811                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
efe  Escherichia fergusonii
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFER_2837 (bglA)
Enzymes [BR:efe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     EFER_2837 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2902108..2903547
Genome map
AA seq 479 aa AA seqDB search
MIVKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVLPGKY
YPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDETQPNEEGLKFYDDMFDE
LLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE
INNQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAARRINPEMKVGC
MLAMVPLYPYSCNPDDVMFAQESMRERYVFTDVQLRGYYPAYVLNEWERRGFNIKMEDGD
LDVLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRY
ALCELYERYQKPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLM
GYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFDWYKEVIASNGEKL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgaaaaaactcaccttaccgaaagatttcttatggggcggcgcagttgccgct
catcaggtcgaaggcggctggaacaaaggcggcaaagggccgagcatttgtgacgttctg
accggtggcgcacacggcgtgccgcgcgaaatcaccaaagaagtcttgccaggaaaatac
tatccaaaccatgaagccgttgatttttatggtcactacaaagaagacatcaagctattt
gccgaaatgggcttcaaatgttttcgcacttccatcgcctggacgcgcattttcccaaaa
ggtgatgaaactcagccaaacgaagaagggctgaagttctacgatgatatgttcgatgaa
ctgctgaaatacaacatcgaaccggtgatcaccctctcccactttgaaatgccgctgcat
ctggtgcagcaatacggtagctggactaaccgtaaagtggttgatttctttgtacgtttc
gcggaagtggtatttgaacgctataagcataaagtcaaatattggatgaccttcaacgaa
attaacaaccagcgtaactggcgtgcacctctgttcggttactgctgctctggcgtggtg
tataccgaacatgaaaacccggaagagacgatgtatcaggtgctgcatcaccagtttgtc
gccagcgccctggcagtgaaagccgcgcgtcgcattaacccggagatgaaagtcggctgt
atgctggcgatggtgccgctctatccatactcctgtaacccggacgatgtgatgttcgct
caggagtcgatgcgcgaacgctacgtctttaccgatgtgcagttgcgtggctattaccct
gcctatgtgttgaacgagtgggagcgtcgcggatttaacatcaaaatggaagacggcgat
ctcgatgtactgcgtgaaggcacctgcgattatcttggtttcagctattacatgaccaac
gcagtgaaggccgaaggcggcaccggcgatgcgatctctggttttgaaggcagcgtacca
aacccgtatgttaaagcatctgactggggctggcagattgatccggtgggtctgcgctat
gcactatgcgaactgtatgagcgttatcagaagccgctgtttattgtcgaaaacggtttt
ggcgcttacgacaaagtggaagaagacggcagcatcaacgacgactaccgcattgattac
ctgcgcgcccatatcgaagaaatgaaaaaagcggtgacttacgatggcgtggatctgatg
ggctacacaccgtggggctgcatcgactgcgtgtcgttcaccaccgggcagtacagcaaa
cgctacggctttatctatgtgaataaacatgacgacggtactggcgatatgtcgcgttca
cgtaagaagagctttgactggtacaaagaggtgattgccagcaacggcgagaagctttaa

DBGET integrated database retrieval system