KEGG   Escherichia fergusonii: EFER_3516Help
Entry
EFER_3516         CDS       T00811                                 

Gene name
bcsZ
Definition
(GenBank) endo-1,4-D-glucanase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
efe  Escherichia fergusonii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3600140..3601246)
Genome map
AA seq 368 aa AA seqDB search
MKVMRCGIVMILMLAAFSVQAACTWPAWEQFKKDYISQEGRVIDPSDARKITTSEGQSYG
MFFALAANDRAAFDNLLDWTQNNLAQGSLKERLPAWLWGKKENSKWEVLDSNSASDGDVW
MAWSLLEAGRLWKEQRYTDIGSALLKRIAREEVVTVPGLGSMLLPGKVGFAEDNSWRFNP
SYLPPTLAQYFTRFGAPWTTLRETNQRLLLETAPKGFSPDWVRYEKDKGWQLKAEKTLIS
SYDAIRVYMWVGMMPDSDPQKARMLNRFKPMATFTEKNGYPPEKVDVATGKAQGKGPVGF
SAAMLPFLQNRDAQSVQRQRVADNFPGSDAYYNYVLTLFGQGWDQHRFRFSSKGELLPDW
GQECANSH
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttatgcgttgtggaatcgtgatgatactgatgctggctgcctttagtgttcag
gcagcctgtacctggcctgcctgggagcagttcaaaaaggattatatcagtcaggaaggg
cgcgtcattgaccccagcgacgcgcgcaaaatcaccacctccgaagggcaaagttatggc
atgttctttgccctggcggctaacgaccgtgcagctttcgataatcttctcgactggacg
cagaacaatctcgctcagggttctttaaaagaacgtttgcccgcctggctgtggggcaag
aaagagaacagtaagtgggaagtgctggacagtaattcggcctccgatggtgatgtctgg
atggcctggtcattgctggaggcggggcgtttgtggaaagagcagcgttataccgacatc
ggcagcgcgttgctaaaacgtatcgcgcgggaggaagtggtgacggtgcctgggctgggt
tccatgttgttgccgggcaaagtgggatttgctgaggataacagctggcgttttaacccc
agctacctgccgccgacgctggcgcagtatttcacccgctttggtgcgccgtggaccacg
ctgcgcgaaaccaatcaacgtttattgctggaaaccgccccgaaaggcttttcaccagac
tgggtgcgttatgagaaagacaaaggttggcagctaaaagctgaaaaaacattgatcagc
agctacgacgcgatccgcgtttacatgtgggtaggcatgatgcctgacagcgatccgcaa
aaagcgcggatgctcaaccggtttaaaccgatggcgacatttactgagaaaaatggttat
ccgccggaaaaagtcgatgtagctacggggaaagcacagggtaaaggaccggtcggtttt
tctgccgctatgctgccctttttacaaaaccgcgatgcgcagtctgttcagcgtcaacgt
gtcgccgataattttcccggcagcgatgcctattacaactatgtgctgactctgttcgga
cagggctgggatcagcaccgttttcgtttttcttcaaaaggtgagttattacctgactgg
ggccaggaatgcgcaaattcacactaa

DBGET integrated database retrieval system