KEGG   Escherichia fergusonii: EFER_3635Help
Entry
EFER_3635         CDS       T00811                                 

Gene name
fadB
Definition
(GenBank) fused 3-hydroxybutyryl-CoA epimerase and delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase and enoyl-CoA hydratase; 3-hydroxyacyl-CoA dehydrogenase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
efe  Escherichia fergusonii
Pathway
efe00071  Fatty acid degradation
efe00280  Valine, leucine and isoleucine degradation
efe00281  Geraniol degradation
efe00310  Lysine degradation
efe00362  Benzoate degradation
efe00380  Tryptophan metabolism
efe00410  beta-Alanine metabolism
efe00640  Propanoate metabolism
efe00650  Butanoate metabolism
efe00903  Limonene and pinene degradation
efe00930  Caprolactam degradation
efe01040  Biosynthesis of unsaturated fatty acids
efe01100  Metabolic pathways
efe01110  Biosynthesis of secondary metabolites
efe01120  Microbial metabolism in diverse environments
efe01130  Biosynthesis of antibiotics
efe01200  Carbon metabolism
efe01212  Fatty acid metabolism
Module
efe_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EFER_3635 (fadB)
   00650 Butanoate metabolism
    EFER_3635 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    EFER_3635 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    EFER_3635 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EFER_3635 (fadB)
   00310 Lysine degradation
    EFER_3635 (fadB)
   00380 Tryptophan metabolism
    EFER_3635 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EFER_3635 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EFER_3635 (fadB)
   00281 Geraniol degradation
    EFER_3635 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EFER_3635 (fadB)
   00930 Caprolactam degradation
    EFER_3635 (fadB)
Enzymes [BR:efe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EFER_3635 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EFER_3635 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EFER_3635 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     EFER_3635 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: CAQ91097
UniProt: B7LTY9
Position
3721917..3724106
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALK
IGLVDGVVKAEKLVEGAKAILRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVK
GKAKKLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRP
DTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVDDLLAEVSQPKRDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPQVEPA
RAVGDLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttacaaaggcgacaccctgtaccttgactggctggaagatggcattgccgaactg
gtatttgatgccccaggttcagttaataaactcgacactgcgaccgtcgccagcctcggc
gaggccatcggcgtgctggaacagcaatcagatttaaaagggctgctgctgcgttcgaat
aaagcagcctttatcgtcggtgctgatatcaccgaatttttgtccctgttcctcgttcct
gaagaacagttaagtcagtggctgcactttgccaatagcgtgtttaatcgcctggaagat
ctgccggtgccgaccattgctgccgtcaacggctatgcgctgggcggtggctgcgaatgc
gtgctggcgaccgattatcgtctggcgacgccggatctgcgcatcggtctgccggaaact
aaactgggcatcatgccgggctttggcggttctgtacgtatgccacgtatgctgggcgct
gacagtgcgctggaaatcattgccgccggtaaagatgtcggcgcggatcaggcgctgaaa
atcggtctggtggatggcgtagtcaaagcagaaaaactggttgaaggcgcgaaggcgatt
ttacgtcaggccattaacggcgacctcgactggaaagcgaaacgtcagccgaagctggaa
ccgctaaaactgagcaagattgaagccaccatgagcttcaccatcgctaaaggaatggtc
gcacaaacagcagggaaacattaccccgcacccatcaccgcagtaaaaaccattgaagcg
gctgcccgttttggtcgagaagaagccctaaacctggaaaacaaaagttttgtcccactg
gcgcataccaacgaagctcgcgcactggtcggcattttccttaacgatcaatatgtaaaa
ggcaaagcgaagaaactcaccaaagacgttgaaaccccgaaacaggccgctgtgctgggc
gcaggcattatgggtggcggcatcgcttaccagtctgcgtggaaaggcgtaccggttgtc
atgaaagatatcaacgacaagtcgttaaccctcggcatgaccgaagccgcgaaactgctg
aacaagcagcttgagcgcggcaagatcgacggtctgaaactggctggcgtgatctccacg
attcatccaacgctcgactacgccgggtttgatcgcgtggatgttgtggtagaagcggta
gtcgaaaacccgaaagtgaaaaaagccgtgctggcagaaaccgagcagaaagtacgcccg
gataccgtgctggcttccaatacttcaaccattcctatcagcgaactggccaacgcgctg
gaacgcccggaaaacttctgcgggatgcatttctttaacccggtccaccggatgccgttg
gtggaaattattcgcggtgagaaaagctccgacgaaaccatcgcgaaagttgtcgcatgg
gcgagcaagatgggtaaaacgccaattgtggttaatgactgccccggcttctttgttaac
cgcgtgctgttcccctacttcgccggtttcagccagctgctgcgtgacggcgcggatttt
cgcaagatcgacaaagtgatggaaaaacagttcggctggccgatgggtccggcatacctg
ctggatgtcgtgggcattgataccgcgcatcacgcccaggcagtgatggcagcaggtttc
ccgcagcggatgcagaaagattatcgcgatgccatcgacgcactgtttgatgccaaccgt
tttggtcagaagaacggcctcggtttctggcgttataaagaagacagcaaaggtaagccg
aagaaagaagaagacgccgccgttgacgacctgctggcagaagtcagccagccgaagcgc
gattttagcgaggaagagattatcgcccgcatgatgatcccgatggtcaacgaagtggtg
cgttgtctggaagaaggcattatcgccactccggcagaagccgatatggcactggtctac
ggcctgggcttccctccgttccacggcggcgcgttccgctggttggacaccctcggtagc
gcaaaatatctcgatatggcacagcaatatcagcacctcggcccgctgtatgaagtgccg
gaaggtctgcgtaataaagcgcgtcataacgaaccgtactatccccaggttgagccagcc
cgtgcggttggcgacctgaaaacggcttaa

DBGET integrated database retrieval system