KEGG   Escherichia fergusonii: EFER_3701Help
Entry
EFER_3701         CDS       T00811                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
efe  Escherichia fergusonii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:efe00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3793393..3794133
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPSPAGEELVSRLRTLGKVAWSFPLIEFTPGRELPTLSRHLETLGDNDLLFALS
QHAVSFAHAQLQQQGLNWPSLPHYFAIGRTTALALHTVSGHKIRYPQDREISEVLLQLPE
LQSIAGKRALILRGNGGRELIGQTLTSRGADVTFCECYQRSAKHYDGAEEAMRWQSRGVT
TVVVTSGEMLQQLWSLIPQWYREHWLLRCRLLVVSERLAILAQELGWQDIQIADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtattctggtcacccgcccgtctcccgccggggaagaattagtgagccgtctgcgc
acactgggcaaggtggcctggagctttccactgattgaatttacccctggccgggagctg
cctacgctctcccgccatctggaaacacttggcgataacgatctgctctttgcactttct
caacatgcagtgtcattcgcccatgcgcagttgcaacagcaggggctaaactggccatca
cttccgcattatttcgctattggccgtactaccgctctcgccctgcacaccgtaagcgga
cataagattcgctatccacaagatcgggaaatcagcgaagtcttgctacaattaccggaa
ttacaaagtattgcgggaaaacgcgcactgattttgcgcggtaacggcggccgtgaattg
atcggtcagacgctgacatcacgtggtgccgacgttactttttgtgaatgttatcaacgc
agtgcgaagcattacgatggtgcggaagaagcaatgcgctggcagtctcgcggcgtaaca
accgtcgttgtaaccagcggtgaaatgctgcaacaactctggtcgctgattccacagtgg
tatcgtgagcactggttactacgctgtcggctactggtcgtcagtgagcgtctggcgatc
cttgcccaggaactgggttggcaagacattcagatcgctgataacgccgacaacgatgcg
ctactacgcgcattacaataa

DBGET integrated database retrieval system