KEGG   Escherichia fergusonii: EFER_3854Help
Entry
EFER_3854         CDS       T00811                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
efe  Escherichia fergusonii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EFER_3854 (tpiA)
   01230 Biosynthesis of amino acids
    EFER_3854 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFER_3854 (tpiA)
   00051 Fructose and mannose metabolism
    EFER_3854 (tpiA)
   00562 Inositol phosphate metabolism
    EFER_3854 (tpiA)
Enzymes [BR:efe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EFER_3854 (tpiA)
Exosome [BR:efe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EFER_3854 (tpiA)
  Exosomal proteins of bladder cancer cells
   EFER_3854 (tpiA)
  Exosomal proteins of melanoma cells
   EFER_3854 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3948347..3949114
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM
LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggttcac
gagctggtttctaacctgcgtaaagagctggcaggtgttgctggctgtgcggttgcaatc
gcaccaccggaaatgtacatcgatatggcgaagcgcgaagctgaaggcagtcacatcatg
ttgggtgcgcagaacgtggatctgaacctgtctggtgcgttcaccggtgaaacctctgct
gcaatgctgaaagacattggcgcacagtacatcattatcggtcactctgaacgtcgtact
taccacaaagaatccgacgaactgatcgcaaaaaaatttgctgtactgaaagaacagggt
ctgactccggtactgtgcatcggtgaaaccgaagcggaaaatgaagcgggcaaaactgaa
gaagtttgtgcacgccagatcgacgcggtactgaaaacgcagggtgctgctgcattcgaa
ggcgcggtaatcgcttacgaaccagtatgggcaatcggtactggcaaatctgcaactccg
gcgcaggcacaggctgttcacaaattcatccgtgaccacatcgctaaagttgacgctaac
atcgctgaacaagtgattatccagtacggcggttctgtaaatgcgtctaatgctgcagaa
ctgttcgctcagccggatatcgacggcgcgctggtgggtggtgcttctctgaaagctgac
gccttcgcagtgatcgttaaagctgccgaggcggctaaacaggcttaa

DBGET integrated database retrieval system