KEGG   Escherichia fergusonii: EFER_3857Help
Entry
EFER_3857         CDS       T00811                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase I
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
efe  Escherichia fergusonii
Pathway
efe00010  Glycolysis / Gluconeogenesis
efe00030  Pentose phosphate pathway
efe00051  Fructose and mannose metabolism
efe00052  Galactose metabolism
efe00680  Methane metabolism
efe01100  Metabolic pathways
efe01110  Biosynthesis of secondary metabolites
efe01120  Microbial metabolism in diverse environments
efe01130  Biosynthesis of antibiotics
efe01200  Carbon metabolism
efe01230  Biosynthesis of amino acids
efe03018  RNA degradation
Module
efe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EFER_3857 (pfkA)
   00030 Pentose phosphate pathway
    EFER_3857 (pfkA)
   00051 Fructose and mannose metabolism
    EFER_3857 (pfkA)
   00052 Galactose metabolism
    EFER_3857 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    EFER_3857 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    EFER_3857 (pfkA)
Enzymes [BR:efe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EFER_3857 (pfkA)
Protein phosphatases and associated proteins [BR:efe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EFER_3857 (pfkA)
Messenger RNA biogenesis [BR:efe03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     EFER_3857 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: CAQ91292
UniProt: B7LVC9
Position
complement(3951169..3952131)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALSEGLEVMGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLA
AAIAGGCEFVVVPEVEFSREDLVNEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIELLLAGYGGRCVGIQNEQLVHHDIIDA
IENMKRPFKGDWLECAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgcctggcatgaacgcagca
atccgtggtgtcgtgcgtgcggcgctttcggaaggtctggaagtcatggggatttatgac
ggctatctgggtctgtatgaagaccgtatggttcagcttgaccgttacagtgtgtccgac
atgatcaaccgcggtggtactttcctgggctccgcgcgcttcccggaattccgcgacgaa
aacatccgtgcggtggctatcgaaaacctgaaaaaacgtggtatcgacgcgctggttgtt
atcggtggtgacggttcttacatgggggcaatgcgtctgactgaaatgggcttcccgtgc
atcggtctgcctggcaccatcgacaacgatatcaaaggtactgactacactatcggcttc
ttcactgccctgagtacggttgtagaagctatcgaccgcctgcgtgacacttcctcttct
caccagcgtatttccgtggtggaagtgatgggccgttattgtggcgatctgactctggca
gctgctattgctggtggttgtgaattcgttgttgtaccggaagttgagttcagccgtgaa
gatctggtaaacgaaattaaagccggtatcgccaaaggtaaaaaacacgcaattgtggcg
atcactgagcacatgtgcgatgtggacgaactggcacacttcattgaaaaagaaaccggt
cgtgaaactcgcgcaaccgtgttgggccacattcagcgtggcggttctccggtaccttac
gaccgtattctggcttcccgtatgggcgcttacgctatcgagctgctgctggctggctac
ggtggtcgctgcgtaggtattcagaacgaacaactggttcaccatgacatcattgatgct
atcgaaaacatgaagcgtccgttcaaaggtgactggctggagtgtgcgaaaaaactgtac
taa

DBGET integrated database retrieval system