KEGG   Escherichia fergusonii: EFER_3958Help
Entry
EFER_3958         CDS       T00811                                 

Definition
glycosyl phosphatase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
efe  Escherichia fergusonii
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:efe00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4060055..4061473
Genome map
AA seq 472 aa AA seqDB search
MNQGVRTMRYRFPDNFWWGSACSALQTEGDSLNGGKSQTTWDVWFERQPGRFHQGVGPAN
TSTFYQHWQQDIALLKQLKHNSFRTSLSWSRLIPDGTGDVNPEAVAFYNNVIDELLAQGI
TPFITLFHFDMPMVMQEKGGWESREVVEAFGEYARTCFELFGNRVKHWFTFNEPIVPVEG
GYLYDFHYPNVVDFKRAATVAYHTVLAHATAVRAFRRGNFEGEIGVVLNLTPSYPRSQNP
ADVKAAHCADLLFNRSFLDPVLKGEYPADLVALLKEYDQLPQCQPDDSQLIADGKIDLLG
INYYQPRRVKCRDSAVNPNAPFMPEWLFDYYEMPGRKMNPYRGWEIYEPGIYDIISNLRD
NYGNPRCFISENGMGVENEQRFIQEGQVNDSYRIEFVAEHLKWLHKGISEGCNCLGYHMW
TFIDNWSWLNAYKNRYGFVQLDLETQTRTIKKSGEWFATVAENNGFDCEKQK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaggagtaagaacaatgagataccgttttcccgacaacttctggtggggtagt
gcttgctctgcgctgcaaaccgaaggggatagtctgaacggcggcaaaagccaaaccacc
tgggatgtatggttcgagcgccagcccggccgcttccatcaaggtgttggcccggcgaac
acatcaaccttttatcaacactggcaacaagatattgccctgctgaaacagttaaaacat
aacagttttcgcacctcgttaagctggtctcgcctgataccagacggtactggtgacgta
aatcctgaagcggtggcgttctataacaatgtcatcgacgagctgctggcgcagggcatc
acaccgtttatcaccttgttccactttgatatgccgatggtgatgcaggaaaaaggtggc
tgggagagtcgtgaagtcgtagaagcttttggtgaatatgcccgtacctgttttgaactg
ttcggtaacagagtgaagcactggtttacctttaacgaaccgattgtgccggtagagggc
ggttatttatatgacttccactatccgaacgttgttgattttaaacgtgctgcgacagtg
gcttaccatacagttcttgcgcacgccacggcagttcgggcattccgccgcggtaatttc
gaaggtgaaattggcgtggtgctcaacctgacgccttcttatccacgctcgcaaaatccg
gctgatgttaaagccgcacactgcgctgaccttctgtttaaccgcagcttcctcgatccg
gtgctaaaaggggaatacccggcagaccttgtagcattactgaaagagtacgatcagttg
ccgcaatgccagcctgacgatagtcagctaatcgccgacggaaaaatcgacctgctgggg
ataaattattatcaaccccgacgcgttaaatgccgggatagcgccgtaaaccccaatgcc
ccctttatgccggagtggttatttgactattacgagatgcctgggcgaaaaatgaatcct
tatcgtggatgggaaatttatgaacccggtatttacgatatcatctccaatcttcgcgat
aattatggtaatcctcgttgttttatttctgaaaatgggatgggtgtagaaaacgagcaa
cgttttattcaggaagggcaagtcaacgatagctatcgtattgaatttgtcgctgaacat
ttaaaatggctgcataaaggaattagcgaagggtgtaattgccttggctatcatatgtgg
acgtttatcgataactggtcatggcttaatgcttataaaaatcgctatggatttgttcag
cttgatctggaaacgcaaacacgtacgattaaaaaaagtggtgagtggtttgcgacagtt
gcagaaaataacggttttgattgcgagaaacaaaaatga

DBGET integrated database retrieval system