KEGG   Escherichia fergusonii: EFER_4149Help
Entry
EFER_4149         CDS       T00811                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (E2 component) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
efe  Escherichia fergusonii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EFER_4149 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EFER_4149 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    EFER_4149 (sucB)
Enzymes [BR:efe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     EFER_4149 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4250268..4251422
Genome map
AA seq 384 aa AA seqDB search
MIEITVPVLPESVTEGTLTTWCKQEGEHVKRDDVIAELETDKVILEIPAPHDGVLSNIIV
SEGSTVTSAQLLAHLKPQAAIEETVTPVTEILAMPSARLEAQRSGVELTDVAGSGRNGRI
LKEDVQRVTPAPATQPERVVEIAPATPVTPGARQERREPMSRLRQRIAERLLASQQNNAI
LTTFNEVNMQSVMDLRARWKDRFAGKHGVKLGFMSFFVKAVTRALERFPIVNASVDGNDI
ILRDYCDIGIAVSSNRGLVVPVLRNAQSLSLVEIERQIAEYATLARNGKLPLEALQGGTF
SITNGGTFGSMMSTPIINPPQSAILGMHAITPRPVAENGQVVIRPMMYLALSYDHRIIDG
QEAVQTLVAIRELLESPEQLLLDL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattactgtccctgtattaccggaatctgtcacggaaggcacgctgacaacc
tggtgtaaacaagaaggcgagcacgtaaagcgtgatgatgtgattgccgagctggaaacc
gataaagtcattctggaaatcccggctccgcacgatggcgtgttaagcaatattatcgtc
agcgaaggtagcacggtcacgtcagcgcaactgttggcgcatcttaagccgcaagctgca
atagaagaaactgtcacaccagtcaccgaaatcctggcgatgccttccgcgcggctggag
gcacagcgtagtggtgtcgaacttactgatgttgcggggagcgggagaaatggacgtatc
ctgaaagaggatgtgcagcgcgtaactcctgcaccagccactcagcctgaacgggtggtg
gagatcgcgccagctacacctgtgacaccgggtgctcgtcaggaacgtcgtgagccgatg
tcgcgcttgcgccagcgaattgctgagcgtctgctggcttcccaacaaaacaacgccatt
ctcaccacgttcaacgaagtaaatatgcagagcgtgatggatttacgcgcccgctggaaa
gatcgttttgccgggaagcacggcgtgaagctgggctttatgtccttctttgttaaggcc
gttacccgggcgctggaacgcttccccattgttaatgccagcgtcgatggcaacgatatt
atcttgcgcgattactgtgatattggcattgcggttagcagcaaccgtggtctggtggtg
cccgtattacgcaatgcgcaatcactctctttggtggaaattgaacggcaaattgccgaa
tacgccacactggcacgcaatggcaaattgccgctggaggcgttacaaggtggtacgttc
tctatcaccaacggcggaacttttggttcgatgatgtcaacgccaatcattaacccgccg
cagtcagccattctcggtatgcatgccatcacgccgcgtccggtggcagaaaatggtcag
gttgttattcgtccgatgatgtaccttgctctcagctatgaccatcgcattattgatggt
caggaagccgtgcagacgctggtggcaatacgcgagctactggagtcaccggaacaactg
ttgctggatctttaa

DBGET integrated database retrieval system