KEGG   Escherichia fergusonii: EFER_4149Help
Entry
EFER_4149         CDS       T00811                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase (E2 component)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
efe  Escherichia fergusonii
Pathway
efe00020  Citrate cycle (TCA cycle)
efe00310  Lysine degradation
efe01100  Metabolic pathways
efe01110  Biosynthesis of secondary metabolites
efe01120  Microbial metabolism in diverse environments
efe01130  Biosynthesis of antibiotics
efe01200  Carbon metabolism
Module
efe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
efe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EFER_4149 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    EFER_4149 (sucB)
Enzymes [BR:efe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     EFER_4149 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: CAQ91571
UniProt: B7LL30
Position
4250268..4251422
Genome map
AA seq 384 aa AA seqDB search
MIEITVPVLPESVTEGTLTTWCKQEGEHVKRDDVIAELETDKVILEIPAPHDGVLSNIIV
SEGSTVTSAQLLAHLKPQAAIEETVTPVTEILAMPSARLEAQRSGVELTDVAGSGRNGRI
LKEDVQRVTPAPATQPERVVEIAPATPVTPGARQERREPMSRLRQRIAERLLASQQNNAI
LTTFNEVNMQSVMDLRARWKDRFAGKHGVKLGFMSFFVKAVTRALERFPIVNASVDGNDI
ILRDYCDIGIAVSSNRGLVVPVLRNAQSLSLVEIERQIAEYATLARNGKLPLEALQGGTF
SITNGGTFGSMMSTPIINPPQSAILGMHAITPRPVAENGQVVIRPMMYLALSYDHRIIDG
QEAVQTLVAIRELLESPEQLLLDL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattactgtccctgtattaccggaatctgtcacggaaggcacgctgacaacc
tggtgtaaacaagaaggcgagcacgtaaagcgtgatgatgtgattgccgagctggaaacc
gataaagtcattctggaaatcccggctccgcacgatggcgtgttaagcaatattatcgtc
agcgaaggtagcacggtcacgtcagcgcaactgttggcgcatcttaagccgcaagctgca
atagaagaaactgtcacaccagtcaccgaaatcctggcgatgccttccgcgcggctggag
gcacagcgtagtggtgtcgaacttactgatgttgcggggagcgggagaaatggacgtatc
ctgaaagaggatgtgcagcgcgtaactcctgcaccagccactcagcctgaacgggtggtg
gagatcgcgccagctacacctgtgacaccgggtgctcgtcaggaacgtcgtgagccgatg
tcgcgcttgcgccagcgaattgctgagcgtctgctggcttcccaacaaaacaacgccatt
ctcaccacgttcaacgaagtaaatatgcagagcgtgatggatttacgcgcccgctggaaa
gatcgttttgccgggaagcacggcgtgaagctgggctttatgtccttctttgttaaggcc
gttacccgggcgctggaacgcttccccattgttaatgccagcgtcgatggcaacgatatt
atcttgcgcgattactgtgatattggcattgcggttagcagcaaccgtggtctggtggtg
cccgtattacgcaatgcgcaatcactctctttggtggaaattgaacggcaaattgccgaa
tacgccacactggcacgcaatggcaaattgccgctggaggcgttacaaggtggtacgttc
tctatcaccaacggcggaacttttggttcgatgatgtcaacgccaatcattaacccgccg
cagtcagccattctcggtatgcatgccatcacgccgcgtccggtggcagaaaatggtcag
gttgttattcgtccgatgatgtaccttgctctcagctatgaccatcgcattattgatggt
caggaagccgtgcagacgctggtggcaatacgcgagctactggagtcaccggaacaactg
ttgctggatctttaa

DBGET integrated database retrieval system