KEGG   Escherichia fergusonii: EFER_4274Help
Entry
EFER_4274         CDS       T00811                                 

Gene name
cysQ
Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
efe  Escherichia fergusonii
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:efe00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4378616..4379356
Genome map
AA seq 246 aa AA seqDB search
MLEQVCLLARMAGDAIMQVYDGTVPMDVASKADNSPVTAADIAAHTVIMDGLRTLTPDIP
VLSEEDPPGWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIDKGKPILGVVYAPVM
KVMYSAAEGKAWKDENGIRKQIQVRDARPPLVVISRSHADAELKEYLQQLGEHQTTSIGS
SLKFCLVAEGQAQLYPRFGPTNIWDTAAGHAVAAAAGAHVNDWQGKPLDYTPRESFLNPG
FRVSIY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacaagtatgcctacttgcacggatggcgggcgacgccattatgcaagtttat
gatggaacagtaccgatggatgtcgccagtaaagccgataactccccggtgacggctgca
gacattgccgcgcataccgtcatcatggacggtttacgtacgctgacgccggatatcccg
gttctctccgaagaagatccgcccggctgggaagtccgccagcactggcagcgttactgg
ctggttgatccgctggatggcaccaaagagtttattaaacgtaatggcgaattcacggta
aacattgccttgatcgacaaaggcaaaccaattctgggtgtggtgtacgcgccggtaatg
aaggtgatgtacagcgcggcagaaggaaaagcctggaaagatgaaaatggtatacgtaag
cagattcaggtacgtgatgctcgcccaccgctggtggtgatcagccgttcccatgccgat
gcggaattgaaagaatatctacaacaacttggcgaacaccagacgacctcaattggctcc
tcactgaagttctgcctggtggcggaagggcaggctcaactctatccgcgtttcgggcca
actaatatttgggataccgctgccggtcacgcagttgcggcagcggccggggcgcatgtt
aatgactggcagggtaaacctctggattacactccgcgtgaatcattcctgaaccccggt
tttcgtgtctctatttactaa

DBGET integrated database retrieval system