KEGG   Enterococcus faecalis OG1RF: OG1RF_10042Help
Entry
OG1RF_10042       CDS       T01882                                 

Gene name
gltX
Definition
glutamate--tRNA ligase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:efi00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    OG1RF_10042 (gltX)
Enzymes [BR:efi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     OG1RF_10042 (gltX)
Amino acid related enzymes [BR:efi01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   OG1RF_10042 (gltX)
Transfer RNA biogenesis [BR:efi03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    OG1RF_10042 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
47609..49084
Genome map
AA seq 491 aa AA seqDB search
MERGMNMTKVRVRYAPSPTGHLHIGNARTALFNYLFARHNDGEFIIRIEDTDQKRNIEDG
EKSQLENLAWLGMEWDESPAHPGEYGPYRQSERKEIYQPLIDQLLSSNRAYKCYCTPEEL
EAEREAQQARGEMPHYAGTCANLTPSEQAAKEAAGLEPVIRFRVPRNTEYKFDDIVKGEI
TFESDNIGGDFVIQKRDGMPTYNFAVAVDDHLMKISHVLRGDDHIANTPKQLMIYEAFEW
TPPVFGHMTLIINSETGKKLSKRDETILQFIEQYRELGYLPEAMFNFIALLGWSPVGEEE
IFSQEDLIKLFDEQRLSKSPAAFDAKKLEWINNQYMKQMDLSELTDMCLPYLVADGRVEE
NPSPEKIEWLKQLVSLYQPQMSYAAEIVELSNLFFNEHPVLDDAAKEFLQGETVPTVLHA
FKEQLEALDVFDVPSIKAAIKAVQKETGVKGKNLFMPIRIAVSGQMHGPELGETIELLGK
EKALDHLNKVL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaggaatgaacatgacgaaagttcgtgtgcgttacgcaccaagtccaactgga
cacttgcacattgggaatgcaagaacagcattatttaactacttatttgcccgccacaat
gacggagaatttatcattcgtatcgaggataccgaccaaaaacggaacatcgaagacggc
gagaaaagtcagttggaaaacttagcatggttagggatggaatgggatgaatcacctgct
catccgggagaatatggtccatatcgtcaatcagaacgtaaagaaatttaccaaccattg
attgatcaattattaagcagcaatcgtgcgtataagtgttattgtacgccagaagaatta
gaagcagaacgtgaagcacaacaagctcgtggggaaatgcctcactacgcaggcacttgt
gcgaatttaacaccttctgaacaagcagccaaagaagcggctggtctagaaccagtgatt
cgtttccgtgtgccacgtaatacagaatacaaatttgatgacatcgtgaaaggtgaaatt
acttttgagtcagataacattggtggcgattttgtcatccaaaaacgcgatgggatgcca
acgtataactttgccgttgcagtagatgatcacttaatgaaaatttctcacgttttacgt
ggcgatgatcacattgcgaacacaccaaaacaattaatgatttacgaagcgtttgaatgg
acaccacctgtctttggccatatgaccttaatcattaattcagaaactggcaaaaaattg
agcaaacgtgatgaaacaattttacaatttattgaacaataccgtgaattaggttactta
ccagaagccatgttcaactttattgctttactaggatggtctcctgttggcgaagaagaa
atcttctcacaagaagacttgattaaattgtttgatgaacaacgcttaagcaagtcacca
gcggcctttgatgcgaaaaaattagaatggattaacaatcaatacatgaaacaaatggac
ttgagtgaactaacagatatgtgtcttccttatttagtcgctgacggtcgtgttgaagaa
aatccatctcctgaaaaaatcgaatggttaaaacaattagttagcttgtatcaaccacaa
atgagttatgcagctgaaattgtggaactatcaaacttgttctttaatgaacatccagtt
ttagatgatgctgcgaaagaattcttgcaaggagaaacagtgccaactgtgttacatgcg
tttaaagaacaattagaagccttggacgttttcgatgtcccaagtattaaagcagcgatt
aaagccgtccaaaaagaaaccggcgttaaaggcaaaaacttgtttatgccaattcgaatt
gctgtttctggacaaatgcatggtcctgaattaggcgaaaccatcgaattattaggcaaa
gaaaaagcattagatcatttaaataaagtgttataa

DBGET integrated database retrieval system