KEGG   Enterococcus faecalis OG1RF: OG1RF_10060Help
Entry
OG1RF_10060       CDS       T01882                                 

Gene name
ruvA
Definition
crossover junction ATP-dependent DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:efi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OG1RF_10060 (ruvA)
Enzymes [BR:efi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     OG1RF_10060 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
68199..68870
Genome map
AA seq 223 aa AA seqDB search
MLCVKMEHMYAISNWKGDNMYEYIIGKVTFVSPYYIVVETNGIGYQISVDNPYRYSGKMD
TDIKLYLHQVVREDAQLLFGFGSLEEKQLFLKLISVSGIGPKSGLAIMASVADHGGLINA
IEGEDVTYLTKFPGVGKKTAQQMILDLKGKLGELESSEAAVAAMTATEAVTTSNQALAEA
LEALSALGYSDREIKRITKQLEALGETTTDVYLSNALKFMMKR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgctttgtgttaaaatggaacatatgtacgcaatcagcaattggaaaggtgacaacatg
tacgaatatattattggaaaagtaacgtttgttagcccatactatattgtcgttgaaaca
aatggcattggctatcagatttcagtcgataacccgtaccgctattcaggaaaaatggat
acggacattaaactatatcttcaccaagtcgtgcgggaagatgcacagctattatttggt
tttggcagtttagaagaaaaacaattgttcttaaaattaatcagtgtctctggaattggc
cctaaaagtggtttagctatcatggcttctgtggctgatcatggtggtttaatcaatgca
attgaaggggaagatgttacatatttaacgaagttcccaggtgttggcaagaaaacagcc
caacaaatgattttagatttaaaaggaaaactaggcgaattagagtcttccgaagcagcg
gtggctgccatgaccgcaaccgaagcggtgacaacaagcaatcaagcattggcagaagcg
ttagaagcattaagtgccctaggctacagtgaccgagagattaagcgtatcactaagcaa
ttggaagcgttaggtgagacaacgacagatgtttatttgagcaatgcgttaaaattcatg
atgaaacgctaa

DBGET integrated database retrieval system