KEGG   Enterococcus faecalis OG1RF: OG1RF_10107Help
Entry
OG1RF_10107       CDS       T01882                                 

Definition
family 20 glycosyl hydrolase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
efi  Enterococcus faecalis OG1RF
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:efi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    OG1RF_10107
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    OG1RF_10107
Enzymes [BR:efi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     OG1RF_10107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
118538..121087
Genome map
AA seq 849 aa AA seqDB search
MVVYALSFLGGYTKMNGVQKGMVFKVGNNLSTRKGENRETIVSWLGLSLLVGLAFILFSL
FHQPMISQANEPTQEKHFMVYYRAWRDKTMQGVNTTLPDENWLTMHDIPYGIDIVNVFSY
VPKGQEALAQPFYDTLKNEYAPALHARGVRLVRGIDYSELLKVPYAGTTPTEAEFDAYAK
ELLTKFVDDLGIDGLDIDMETRPSEKDIVLSNGVIRALSKYIGPKSGTDRPFLYDTNAEY
LPPLQDVSDCFDFLAYQQYGSDDQRTQRALNNLSPVLNGERFVPGLTFPEEQDRNRWYDT
KEPYMESNMYKVARYSYENNLGGMFLYALDRDGRTYNEDDLNQIKPSNLLWTKTAIAESK
GVSLAEMKAAAQHYLKRISYANTDLEAQNKAAEAVTQATTLYDVNKAILGGDYGQGISNT
YDAELEKGLLAIDLTTLYRALDQAVTAIEKAESYTPETIQALQTTKETVATELAGKTYTA
AQVTTWQTEVQTALDNLKEKQTQPLKSVFSIDAGRKYFSVEQLEELVAKASQNGYTDVQL
ILGNDGLRFILDDMSVNVNGKKYNHNRVSKAIQRGNNAYYNDPNGNALTQKEMDRLLAFA
KARNINIIPVINSPGHMDALLVAMEKLAIKNPAFDGSKRTVDLGNQKAVNFTKAIISKYV
AYFSAHSEIFNFGGDEYANDVDTGGWAKLQSSGRYKDFVAYANDLAKIIKDAGMQPMSFN
DGIYYNSDDSFGTFDPEIIISYWTAGWSGYDVAKPEYFVQKGHKIFNTNDAWYWVAGNVD
SGIYQYDDALANMSKKAFTDVPAGSPNLPIIGSIQCVWYDDPRRDYDFERIYTLMDTFSE
NYREYMVVK
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atggttgtgtatgcgctttcttttttaggtggatacacaaaaatgaacggagtgcagaaa
ggaatggtgttcaaagtggggaacaatttatcgacaagaaaaggagaaaacagagaaaca
attgtcagttggctgggtctttcgttattggttggcttggcgtttatcttatttagtctg
tttcatcaaccaatgatcagccaagccaatgagccgacccaagagaaacattttatggtt
tattatcgggcttggcgtgacaaaacgatgcaaggagttaatacaacattgccagatgaa
aattggctaacgatgcacgatattccttatggtattgacattgtgaatgtctttagttat
gtgccaaaaggacaagaagcacttgcacagccattttatgatacgttaaaaaatgagtat
gcgccagcactgcatgcacgaggtgttcgtttagttcgtgggattgattacagcgagcta
ttaaaagttccttacgcaggaacaacgcctacagaagcagaatttgatgcttatgcgaaa
gagttgttaaccaaatttgtcgatgatttaggaattgatgggttagatattgacatggaa
actcgtccaagtgaaaaagatattgttctatctaatggtgtcattcgtgcattatcaaaa
tacattggaccgaagtcgggaacggatcgtccatttttgtatgataccaatgcagaatat
ttaccacctttacaagatgtcagtgactgtttcgattttctcgcgtatcaacagtatggc
agcgatgaccaacgcacgcaacgagcattaaataatttaagtccggttctcaatggggaa
cgatttgttccaggattaactttcccagaagagcaagatcgcaaccgctggtatgacaca
aaagagccgtatatggaaagtaacatgtataaagtagctcgttattcttatgaaaataat
ttagggggcatgttcctctatgccttagatcgcgatggtcgcacctataatgaagacgat
ttaaatcagataaaaccttctaatttactttggacaaaaacggccattgcagagagtaaa
ggcgtttctcttgcagagatgaaagcggctgcgcaacactatttaaaacgaattagctac
gccaacacagaccttgaagcacaaaataaagccgcagaagcagtgacacaagcaacaacg
ctttatgatgtgaataaagctattttaggtggcgattatggccaagggatttcaaacacc
tatgatgctgaattagaaaaaggcctgttagccattgacttaaccactttatatcgtgcg
ttggatcaagcagttacagccattgaaaaggcagaaagctatacaccagaaacgattcaa
gcactacaaacaacaaaagagacagtcgcaacagaacttgcgggaaaaacgtatacagcc
gcgcaagtgactacttggcaaacggaggtccaaacagctttggataatttaaaagagaaa
caaacacaacctttaaaaagtgtcttttccattgatgcgggaagaaaatatttttccgtg
gaacaactggaagaattagtggccaaagccagtcaaaatgggtacacagatgtccaatta
attttaggaaatgatggcttacggtttatcttggatgatatgtcggtcaatgtgaatggt
aaaaaatacaaccacaaccgggtttcaaaagcaatccaacgaggcaacaacgcgtattac
aatgaccctaatggcaacgcgttaacacaaaaagaaatggatcggttgttggcttttgcg
aaagcgcgcaacatcaacatcattcccgtgattaacagtccaggacatatggatgccttg
ttagtggccatggaaaaactagcgattaaaaatcccgcttttgatggctcaaaacgaaca
gtagatttagggaaccaaaaggcagtgaatttcacaaaggcgattatcagtaagtacgtg
gcttatttttccgcgcatagtgaaattttcaattttggtggcgatgagtatgcaaatgat
gtcgatacaggcggttgggcaaaactgcaatcttctgggcgctacaaggattttgtcgct
tatgcgaatgatttagctaaaataattaaagatgcgggcatgcagccaatgagcttcaat
gatggcatttattacaacagcgacgattctttcggtacatttgacccagagattattatt
tcttattggacagccggttggagcggatatgacgtagccaaacctgagtactttgttcaa
aaaggacacaaaatttttaataccaatgatgcgtggtattgggtagctggcaatgttgat
tctggcatttatcaatatgatgatgctttagcaaatatgtcgaaaaaagcatttacagat
gtgccagcaggtagccctaatcttccaattattggaagtattcaatgtgtttggtatgat
gaccctcgtcgtgactatgattttgaacgaatttatacgctaatggatacgttctcggaa
aattatcgtgagtatatggtggttaaataa

DBGET integrated database retrieval system